From AureoWiki
(Redirected from JSNZ 000792)
Jump to navigation Jump to search

NCBI: 01-DEC-2025

Summary[edit | edit source]

  • organism: Staphylococcus aureus JSNZ
  • locus tag: EGJ38_000792 [new locus tag: EGJ38_RS03955 ]
  • pan locus tag?: SAUPAN002821000
  • symbol: gcvH
  • pan gene symbol?: gcvH
  • synonym:
  • alternate name: JSNZ_000792
  • product: glycine cleavage system protein GcvH

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: EGJ38_000792 [new locus tag: EGJ38_RS03955 ]
  • symbol: gcvH
  • product: glycine cleavage system protein GcvH
  • replicon: chromosome
  • strand: +
  • coordinates: 823624..824004
  • length: 381
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Gene ID:
  • RefSeq: MGT2422767 NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    TTGGCAGTACCAAATGAATTGAAATATTCAAAAGAGCATGAATGGGTTAAAGTTGAAGGT
    AATGTAGCAACAATTGGAATCACAGAATACGCACAAAGCGAGTTAGGTGATATTGTTTTC
    GTTGAATTACCAGAAACAGATGATGAAATTAATGAAGGGGATACGTTTGGTAGCGTAGAA
    TCAGTTAAAACTGTATCAGAATTATATGCACCAATCTCTGGTAAAGTAGTTGAAGTCAAC
    GAAGAACTAGAAGATAGTCCCGAATTTGTAAATGAATCTCCATACGAAAAAGCATGGATG
    GTAAAAGTAGAAATTAGTGATGAAAGTCAGCTTGAAGCTTTATTAACAGCTGAAAAATAT
    TCAGAAATGATTGGTGAATAA
    60
    120
    180
    240
    300
    360
    381

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: EGJ38_000792 [new locus tag: EGJ38_RS03955 ]
  • symbol: GcvH
  • description: glycine cleavage system protein GcvH
  • length: 126
  • theoretical pI: 3.70004
  • theoretical MW: 14080.4
  • GRAVY: -0.380159

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Amino acids and amines glycine cleavage system H protein (TIGR00527; HMM-score: 185.4)
    and 3 more
    glycine cleavage protein H-like protein (TIGR03077; HMM-score: 70.4)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis acetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 15.5)
    Metabolism Central intermediary metabolism Nitrogen metabolism urea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 11)
  • TheSEED: data available for COL, N315, NCTC8325, Newman, USA300_FPR3757
  • PFAM:
    Hybrid (CL0105) GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 168.3)
    and 2 more
    Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 16.2)
    RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 15.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9948
    • Cytoplasmic Membrane Score: 0.0007
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0045
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003675
    • TAT(Tat/SPI): 0.000219
    • LIPO(Sec/SPII): 0.00034
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI:
  • RefSeq: MGT2422767 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MAVPNELKYSKEHEWVKVEGNVATIGITEYAQSELGDIVFVELPETDDEINEGDTFGSVESVKTVSELYAPISGKVVEVNEELEDSPEFVNESPYEKAWMVKVEISDESQLEALLTAEKYSEMIGE

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: CcpA regulon
    CcpA(TF)important in Carbon catabolism;  regulation predicted or transferred from N315 and NCTC 8325  [1]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Hannes Wolfgramm, Larissa Milena Busch, Jöran Tebben, Henry Mehlan, Lisa Hagenau, Thomas Sura, Tilly Hoffmüller, Elisa Bludau, Manuela Gesell Salazar, Alexander Reder, Stephan Michalik, Leif Steil, Kristin Surmann, Ulrike Mäder, Silva Holtfreter, Uwe Völker
    Integrated genomic and proteomic analysis of the mouse-adapted Staphylococcus aureus strain JSNZ.
    Curr Res Microb Sci: 2025, 9;100489
    [PubMed:41146725] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]