From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0791 [new locus tag: SAUSA300_RS04270 ]
  • pan locus tag?: SAUPAN002821000
  • symbol: gcvH
  • pan gene symbol?: gcvH
  • synonym:
  • product: glycine cleavage system protein H

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0791 [new locus tag: SAUSA300_RS04270 ]
  • symbol: gcvH
  • product: glycine cleavage system protein H
  • replicon: chromosome
  • strand: +
  • coordinates: 876197..876577
  • length: 381
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    TTGGCAGTACCAAATGAATTGAAATATTCAAAAGAGCATGAATGGGTTAAAGTTGAAGGT
    AATGTAGCAATAATTGGAATCACAGAATACGCACAAAGCGAGTTAGGTGATATTGTTTTC
    GTTGAATTACCAGAAACAGATGATGAAATTAATGAAGGGGATACGTTTGGTAGCGTAGAA
    TCAGTTAAAACTGTATCAGAATTATATGCACCAATCTCTGGTAAAGTAGTTGAAGTCAAC
    GAAGAACTAGAAGATAGTCCCGAATTTGTAAATGAATCTCCATACGAAAAAGCATGGATG
    GTAAAAGTAGAAATTAGTGATGAAAGTCAGATTGAAGCTTTATTAACAGCTGAAAAATAT
    TCAGAAATGATTGGTGAATAA
    60
    120
    180
    240
    300
    360
    381

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_0791 [new locus tag: SAUSA300_RS04270 ]
  • symbol: GcvH
  • description: glycine cleavage system protein H
  • length: 126
  • theoretical pI: 3.70004
  • theoretical MW: 14092.5
  • GRAVY: -0.333333

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Amino acids and amines glycine cleavage system H protein (TIGR00527; HMM-score: 184.5)
    and 3 more
    glycine cleavage protein H-like protein (TIGR03077; HMM-score: 69.5)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis acetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 15.2)
    Metabolism Central intermediary metabolism Nitrogen metabolism urea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 11.1)
  • TheSEED  :
    • Glycine cleavage system H protein
    Amino Acids and Derivatives Alanine, serine, and glycine Glycine and Serine Utilization  Glycine cleavage system H protein
    and 1 more
    Amino Acids and Derivatives Alanine, serine, and glycine Glycine cleavage system  Glycine cleavage system H protein
  • PFAM:
    Hybrid (CL0105) GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 164.8)
    and 2 more
    Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 16.5)
    RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 16.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors: (R)-lipoate
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003128
    • TAT(Tat/SPI): 0.000167
    • LIPO(Sec/SPII): 0.000284
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MAVPNELKYSKEHEWVKVEGNVAIIGITEYAQSELGDIVFVELPETDDEINEGDTFGSVESVKTVSELYAPISGKVVEVNEELEDSPEFVNESPYEKAWMVKVEISDESQIEALLTAEKYSEMIGE

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: CcpA regulon
    CcpA(TF)important in Carbon catabolism; RegPrecise 

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_0791&oldid=93132"