From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0410 [new locus tag: NWMN_RS02315 ]
  • pan locus tag?: SAUPAN002148000
  • symbol: lpl7nm
  • pan gene symbol?: lpl7
  • synonym:
  • product: tandem lipoprotein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0410 [new locus tag: NWMN_RS02315 ]
  • symbol: lpl7nm
  • product: tandem lipoprotein
  • replicon: chromosome
  • strand: +
  • coordinates: 459134..459949
  • length: 816
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGATGGGGTATATAAAAAGAATGGCTTTATACATGAGTGTATTTCTTTTAATCATTTTT
    ATTGTTGGATGTCGAAATATGAAAGATGAACAGAAAAAAGAAGAACAAACAAATAAAACA
    GATTCAAAAGAAGAACAAATCAAAAAGAGTTTTGAGAAAACATTAGATATGTATCCAATT
    AAGAATCTCGAGGAGTTATACGACAAAGAAGGATACCGAGATGGCGAATTTAAAAAGGGT
    GATAAAGGGATGTGGACGATATATACAGATTTCGCCAAAAGTAATAAACAAGGTGGATTG
    AGTAATGAAGGTATGGTCTTATACTTAGATAGAAATACACGGACTGCAAAGGGACATTAT
    TTTGTTAAGACATTCTATAATAAGGGCAAATTCCCAGATAGAAAAAATTATAAAGTTGAA
    ATGAAAAATAATAAAATTATCTTATTAGATAAAGTAGAAGATACAAATCTAAAAAAGAGA
    ATAGAAAACTTTAAATTTTTTGGACAATATGCAAACCTTAAAGAATTGAAAAACTACAAC
    AATGGTGATGTCTCAATTAATGAGAATGTTCCAAGTTATGACGCAAAATTTAAAATGAGC
    AATAAAGATGAAAATGTTAAGCAATTAAGAAGTCGTTATAATATTCCTACTGATAAAGCA
    CCGGTATTAAAAATGCATATTGATGGTAATTTGAAAGGAAGTTCTGTGGGTTATAAAAAG
    TTGGAAATTGACTTTTCAAAAGGTGGAAAAAGCGATTTGTCAGTAATAGATTCTTTGAAT
    TTCCAGCCGGCGAAGGTAGATGAAGATGATGAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    816

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0410 [new locus tag: NWMN_RS02315 ]
  • symbol: Lpl7nm
  • description: tandem lipoprotein
  • length: 271
  • theoretical pI: 9.6824
  • theoretical MW: 31631
  • GRAVY: -0.906273

Function[edit source | edit]

  • TIGRFAM:
    Staphylococcus tandem lipoproteins (TIGR01742; HMM-score: 421.6)
  • TheSEED:  
    Tandem lipoprotein within Pathogenicity island
  • PFAM:
    LolA_LolB (CL0048) DUF576; Csa1 family (PF04507; HMM-score: 370.5)
    and 2 more
    Adhesin (CL0204) DUF2807; Putative auto-transporter adhesin, head GIN domain (PF10988; HMM-score: 13)
    no clan definedETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helix: 1
  • LocateP: Lipid anchored
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPII)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: IFIVGCR
  • SignalP: Signal peptide LIPO(Sec/SPII) length 23 aa
    • SP(Sec/SPI): 0.000415
    • TAT(Tat/SPI): 0.000057
    • LIPO(Sec/SPII): 0.999193
    • Cleavage Site: CS pos: 23-24. IVG-CR. Pr: 0.9998
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MMGYIKRMALYMSVFLLIIFIVGCRNMKDEQKKEEQTNKTDSKEEQIKKSFEKTLDMYPIKNLEELYDKEGYRDGEFKKGDKGMWTIYTDFAKSNKQGGLSNEGMVLYLDRNTRTAKGHYFVKTFYNKGKFPDRKNYKVEMKNNKIILLDKVEDTNLKKRIENFKFFGQYANLKELKNYNNGDVSINENVPSYDAKFKMSNKDENVKQLRSRYNIPTDKAPVLKMHIDGNLKGSSVGYKKLEIDFSKGGKSDLSVIDSLNFQPAKVDEDDE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • regulator: SaeR (activation) regulon
    SaeR(TF)important in Virulence; RegPrecise    transcription unit transferred from N315 data RegPrecise  

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]