PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 06-JUL-2013

⊟Summary

• organism: Staphylococcus aureus Newman
• locus tag: NWMN_0965 [new locus tag: NWMN_RS05410 ]
• pan locus tag^?: SAUPAN003323000
• symbol: potA
• pan gene symbol^?: potA
• synonym:
• product: spermidine/putrescine ABC transporter ATP-binding protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: NWMN_0965 [new locus tag: NWMN_RS05410 ]
• symbol: potA
• product: spermidine/putrescine ABC transporter ATP-binding protein
• replicon: chromosome
• strand: +
• coordinates: 1071142..1072236
• length: 1095
• essential: unknown other strains

⊟Accession numbers

• Gene ID: 5330576 NCBI
• RefSeq: YP_001331999 NCBI
• BioCyc:
• MicrobesOnline: 3706516 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  241
  301
  361
  421
  481
  541
  601
  661
  721
  781
  841
  901
  961
  1021
  1081
  
  TTGGAACCGTTATTATCATTAAAATCAGTTAGTAAAAGCTATGATGATCTTAATATCTTA
  GATGACATAGATATTGATATTGAATCAGGATACTTTTATACATTATTAGGTCCTTCAGGT
  TGTGGTAAAACAACAATTTTAAAATTAATTGCAGGGTTTGAATATCCTGACAGTGGTGAA
  GTGATTTATCAAAACAAACCAATTGGTAATTTACCACCAAATAAACGTAAAGTGAATACA
  GTCTTTCAAGATTATGCATTATTTCCACACTTAAACGTCTATGATAATATCGCTTTTGGT
  TTGAAATTAAAAAAATTATCAAAAACCGAAATTGATCAAAAAGTAACTGAGGCATTAAAA
  TTAGTAAAACTTTCAGGTTATGAAAAAAGAAATATTAATGAAATGAGTGGCGGACAAAAG
  CAACGTGTTGCAATTGCACGTGCTATCGTAAATGAACCAGAAATATTATTGTTAGATGAA
  TCTTTATCCGCATTAGATTTGAAATTGCGTACTGAAATGCAATATGAATTACGAGAATTG
  CAATCTAGATTAGGTATTACATTTATATTTGTAACACATGATCAAGAAGAAGCGTTAGCA
  TTAAGTGACTTTCTTTTTGTATTAAAAGATGGGAAAATTCAACAATTTGGCACACCAACA
  GATATATATGACGAACCAGTGAATCGATTTGTAGCTGATTTTATTGGAGAATCTAATATT
  GTTGAAGGGCGCATGGTTAGAGATTATGTCGTGAATATTTATGGGCAAGATTTCGAATGT
  GTCGATATGGGTATTCCTGAAAATAAAAAAGTAGAAGTCGTTATTCGACCAGAAGATATA
  TCATTAATCAAAGCTGAAGAAGGATTATTTAAAGCAACTGTTGATTCTATGTTATTTAGA
  GGGGTCCACTATGAAATATGTTGTATAGACAATAAAGGTTATGAATGGGTAATACAAACG
  ACTAAAAAAGCTGAAGTAGGCAGTGAAGTTGGTCTTTATTTTGATCCTGAAGCCATTCAT
  ATTATGGTTCCTGGAGAAACAGAAGAAGAATTTGATAAACGTATTGAAAGCTATGAGGAA
  GTAGACAATGCGTAA
  60
  120
  180
  240
  300
  360
  420
  480
  540
  600
  660
  720
  780
  840
  900
  960
  1020
  1080
  1095
  

⊟Protein

⊟General

• locus tag: NWMN_0965 [new locus tag: NWMN_RS05410 ]
• symbol: PotA
• description: spermidine/putrescine ABC transporter ATP-binding protein
• length: 364
• theoretical pI: 4.36604
• theoretical MW: 41329.8
• GRAVY: -0.231868

⊟Function

• reaction:
  EC 3.6.3.31?  ExPASy
  Polyamine-transporting ATPase ATP + H₂O + polyamine(Out) = ADP + phosphate + polyamine(In)
• TIGRFAM:
  Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 354.1)
  Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 351.8)
  2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 292.7)
  and 71 more
  Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 273.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 227)
  Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 186)
  Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 174.5)
  Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 166.5)
  Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 166.2)
  Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 164.3)
  Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 164.3)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 161)
  Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 159.2)
  Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 159.2)
  Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 156.6)
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 151.1)
  Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 147.9)
  D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 143.8)
  Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 142.5)
  ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 142)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 138.8)
  Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 135)
  Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 130.9)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 130.8)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 130)
  ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 129.3)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 128.3)
  Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 128.3)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 122.4)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 122.4)
  proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 121.8)
  lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 120.5)
  Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 117.7)
  Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 113.2)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 113.2)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 111.2)
  Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 111.1)
  Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 111.1)
  Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 110)
  Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 110)
  thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 108.8)
  Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 108.2)
  Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 108.2)
  ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 107.6)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102)
  Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 102)
  gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 101.3)
  Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 98)
  thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 97.6)
  Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 96)
  Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 95.5)
  Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 90.6)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)
  Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)
  Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 90)
  Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 88.2)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 87)
  Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 78.3)
  ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 77)
  Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 71)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 68.5)
  Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 68)
  Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 68)
  phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 64.2)
  Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 63.1)
  Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 58.8)
  Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 49.2)
  Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 44.5)
  Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 42.7)
  Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 36.3)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 22.1)
  ribosomal protein eL8 (TIGR03677; HMM-score: 15.9)
  Cellular processes Cellular processes Chemotaxis and motility flagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 12.2)
  Genetic information processing DNA metabolism DNA replication, recombination, and repair checkpoint protein rad24 (TIGR00602; HMM-score: 11.3)
• TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
• PFAM:
  P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 118.2)
  and 14 more
  OB (CL0021) TOBE_2; TOBE domain (PF08402; HMM-score: 34.6)
  P-loop_NTPase (CL0023) AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 31.9)
  SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 24.4)
  AAA_22; AAA domain (PF13401; HMM-score: 22.9)
  AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 17.8)
  AAA_28; AAA domain (PF13521; HMM-score: 17.5)
  AAA_15; AAA ATPase domain (PF13175; HMM-score: 15.5)
  AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 14.2)
  AAA_23; AAA domain (PF13476; HMM-score: 14)
  RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 13.8)
  ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13.5)
  AAA_16; AAA ATPase domain (PF13191; HMM-score: 12.5)
  AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 12.3)
  Rad17; Rad17 cell cycle checkpoint protein (PF03215; HMM-score: 11.4)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic Membrane
  • Cytoplasmic Score: 0.04
  • Cytoplasmic Membrane Score: 9.96
  • Cellwall Score: 0
  • Extracellular Score: 0
  • Internal Helices: 0
• LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 1
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: 1
  • Predicted Cleavage Site: No CleavageSite
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.01071
  • TAT(Tat/SPI): 0.000593
  • LIPO(Sec/SPII): 0.002746
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 151221177 NCBI
• RefSeq: YP_001331999 NCBI
• UniProt: A0A0H3K7E2 UniProt

⊟Protein sequence

• MEPLLSLKSVSKSYDDLNILDDIDIDIESGYFYTLLGPSGCGKTTILKLIAGFEYPDSGEVIYQNKPIGNLPPNKRKVNTVFQDYALFPHLNVYDNIAFGLKLKKLSKTEIDQKVTEALKLVKLSGYEKRNINEMSGGQKQRVAIARAIVNEPEILLLDESLSALDLKLRTEMQYELRELQSRLGITFIFVTHDQEEALALSDFLFVLKDGKIQQFGTPTDIYDEPVNRFVADFIGESNIVEGRMVRDYVVNIYGQDFECVDMGIPENKKVEVVIRPEDISLIKAEEGLFKATVDSMLFRGVHYEICCIDNKGYEWVIQTTKKAEVGSEVGLYFDPEAIHIMVPGETEEEFDKRIESYEEVDNA

⊟Experimental data

• experimentally validated: data available for COL, NCTC8325
• protein localization: data available for COL
• quantitative data / protein copy number per cell: data available for COL
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: NWMN_0964 > potA > potB > potC > NWMN_0968 > NWMN_0969

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: data available for COL

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications