Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_2286 [new locus tag: NWMN_RS13155 ]
- pan locus tag?: SAUPAN005913000
- symbol: NWMN_2286
- pan gene symbol?: sarZ
- synonym:
- product: MarR family regulatory protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_2286 [new locus tag: NWMN_RS13155 ]
- symbol: NWMN_2286
- product: MarR family regulatory protein
- replicon: chromosome
- strand: +
- coordinates: 2512103..2512549
- length: 447
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5331400 NCBI
- RefSeq: YP_001333320 NCBI
- BioCyc:
- MicrobesOnline: 3707888 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGTATGTAGAAAACAGCTATCTTAGCAAACAGTTGTGTTTTTTATTTTATGTTTCTTCA
AAAGAAATAATTAAAAAATACACAAACTATCTTAAGGAATATGATTTAACCTATACTGGT
TACATTGTTTTAATGGCGATTGAAAATGATGAAAAACTTAACATCAAAAAATTAGGTGAA
CGTGTGTTCTTAGATTCTGGAACACTGACACCATTACTAAAGAAATTAGAAAAGAAAGAT
TACGTTGTTCGAACACGTGAAGAGAAAGATGAAAGAAACCTACAAATTTCTCTAACAGAA
CAAGGTAAAGCAATAAAAAGCCCTCTTGCTGAAATTTCTGTTAAGGTCTTTAATGAATTC
AACATTTCAGAACGAGAAGCATCAGATATAATTAATAATTTGCGGAATTTTGTTTCTAAA
AATTTTGACTATTCCGACAAAAAATAA60
120
180
240
300
360
420
447
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_2286 [new locus tag: NWMN_RS13155 ]
- symbol: NWMN_2286
- description: MarR family regulatory protein
- length: 148
- theoretical pI: 8.82125
- theoretical MW: 17434.9
- GRAVY: -0.526351
⊟Function[edit | edit source]
- TIGRFAM: homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 46.8)Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 43.7)and 2 moremobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 30.8)Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 14.4)
- TheSEED :
- Transcriptional regulator SarZ (Staphylococcal accessory regulator Z)
- PFAM: HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 69.1)and 9 moreMarR; MarR family (PF01047; HMM-score: 49.8)MarR_2; MarR family (PF12802; HMM-score: 39.4)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 32.6)HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 23.2)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 20.2)PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 19.1)Mga; Mga helix-turn-helix domain (PF05043; HMM-score: 19.1)HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 16.8)DUF6293_C; DUF6293 C-terminal winged helix domain (PF22665; HMM-score: 15.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9376
- Cytoplasmic Membrane Score: 0.0059
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0564
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006838
- TAT(Tat/SPI): 0.000141
- LIPO(Sec/SPII): 0.012834
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MYVENSYLSKQLCFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVSKNFDYSDKK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]