From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2331 [new locus tag: SAUSA300_RS12880 ]
  • pan locus tag?: SAUPAN005913000
  • symbol: SAUSA300_2331
  • pan gene symbol?: sarZ
  • synonym:
  • product: MarR family transcriptional regulator

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2331 [new locus tag: SAUSA300_RS12880 ]
  • symbol: SAUSA300_2331
  • product: MarR family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 2507172..2507618
  • length: 447
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTATGTAGAAAACAGCTATCTTAGCAAACAGTTGTGTTTTTTATTTTATGTTTCTTCA
    AAAGAAATAATTAAAAAATACACAAACTATCTTAAGGAATATGATTTAACCTATACTGGT
    TACATTGTTTTAATGGCGATTGAAAATGATGAAAAACTTAACATCAAAAAATTAGGTGAA
    CGTGTGTTCTTAGATTCTGGAACACTGACACCATTACTAAAGAAATTAGAAAAGAAAGAT
    TACGTTGTTCGAACACGTGAAGAGAAAGATGAAAGAAACCTACAAATTTCTCTAACAGAA
    CAAGGTAAAGCAATAAAAAGCCCTCTTGCTGAAATTTCTGTTAAGGTCTTTAATGAATTC
    AACATTTCAGAACGAGAAGCATCAGATATAATTAATAATTTGCGGAATTTTGTTTCTAAA
    AATTTTGACTATTCCGACAAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    447


Protein[edit | edit source]

Protein Data Bank: 3HRM
Protein Data Bank: 3HSE
Protein Data Bank: 3HSR
Protein Data Bank: 4GXO

General[edit | edit source]

  • locus tag: SAUSA300_2331 [new locus tag: SAUSA300_RS12880 ]
  • symbol: SAUSA300_2331
  • description: MarR family transcriptional regulator
  • length: 148
  • theoretical pI: 8.82125
  • theoretical MW: 17434.9
  • GRAVY: -0.526351

Function[edit | edit source]

  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 46.8)
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 43.7)
    and 2 more
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 30.8)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 14.4)
  • TheSEED  :
    • Transcriptional regulator SarZ (Staphylococcal accessory regulator Z)
  • PFAM:
    HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 69.1)
    and 9 more
    MarR; MarR family (PF01047; HMM-score: 49.8)
    MarR_2; MarR family (PF12802; HMM-score: 39.4)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 32.6)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 23.2)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 20.2)
    PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 19.1)
    Mga; Mga helix-turn-helix domain (PF05043; HMM-score: 19.1)
    HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 16.8)
    DUF6293_C; DUF6293 C-terminal winged helix domain (PF22665; HMM-score: 15.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9376
    • Cytoplasmic Membrane Score: 0.0059
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0564
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006838
    • TAT(Tat/SPI): 0.000141
    • LIPO(Sec/SPII): 0.012834
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MYVENSYLSKQLCFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVSKNFDYSDKK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]