Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2384 [new locus tag: SACOL_RS12510 ]
- pan locus tag?: SAUPAN005913000
- symbol: sarZ
- pan gene symbol?: sarZ
- synonym:
- product: accessory protein Z
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2384 [new locus tag: SACOL_RS12510 ]
- symbol: sarZ
- product: accessory protein Z
- replicon: chromosome
- strand: +
- coordinates: 2443605..2444051
- length: 447
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238645 NCBI
- RefSeq: YP_187188 NCBI
- BioCyc: see SACOL_RS12510
- MicrobesOnline: 913864 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGTATGTAGAAAACAGCTATCTTAGCAAACAGTTGTGTTTTTTATTTTATGTTTCTTCA
AAAGAAATAATTAAAAAATACACAAACTATCTTAAGGAATATGATTTAACCTATACTGGT
TACATTGTTTTAATGGCGATTGAAAATGATGAAAAACTTAACATCAAAAAATTAGGTGAA
CGTGTGTTCTTAGATTCTGGAACACTGACACCATTACTAAAGAAATTAGAAAAGAAAGAT
TACGTTGTTCGAACACGTGAAGAGAAAGATGAAAGAAACCTACAAATTTCTCTAACAGAA
CAAGGTAAAGCAATAAAAAGCCCTCTTGCTGAAATTTCTGTTAAGGTCTTTAATGAATTC
AACATTTCAGAACGAGAAGCATCAGATATAATTAATAATTTGCGGAATTTTGTTTCTAAA
AATTTTGACTATTCCGACAAAAAATAA60
120
180
240
300
360
420
447
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2384 [new locus tag: SACOL_RS12510 ]
- symbol: SarZ
- description: accessory protein Z
- length: 148
- theoretical pI: 8.82125
- theoretical MW: 17434.9
- GRAVY: -0.526351
⊟Function[edit | edit source]
- TIGRFAM: homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 46.8)Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 43.7)and 2 moremobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 30.8)Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 14.4)
- TheSEED :
- Transcriptional regulator SarZ (Staphylococcal accessory regulator Z)
- PFAM: HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 69.1)and 9 moreMarR; MarR family (PF01047; HMM-score: 49.8)MarR_2; MarR family (PF12802; HMM-score: 39.4)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 32.6)HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 23.2)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 20.2)PadR; Transcriptional regulator PadR-like family (PF03551; HMM-score: 19.1)Mga; Mga helix-turn-helix domain (PF05043; HMM-score: 19.1)HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 16.8)DUF6293_C; DUF6293 C-terminal winged helix domain (PF22665; HMM-score: 15.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9376
- Cytoplasmic Membrane Score: 0.0059
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0564
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006838
- TAT(Tat/SPI): 0.000141
- LIPO(Sec/SPII): 0.012834
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MYVENSYLSKQLCFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDEKLNIKKLGERVFLDSGTLTPLLKKLEKKDYVVRTREEKDERNLQISLTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVSKNFDYSDKK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 127 [5]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 8.38 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Stephan Fuchs, Jan Pané-Farré, Christian Kohler, Michael Hecker, Susanne Engelmann
Anaerobic gene expression in Staphylococcus aureus.
J Bacteriol: 2007, 189(11);4275-89
[PubMed:17384184] [WorldCat.org] [DOI] (P p)