From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2480 [new locus tag: NWMN_RS14240 ]
  • pan locus tag?: SAUPAN006257000
  • symbol: NWMN_2480
  • pan gene symbol?:
  • synonym:
  • product: hydrolase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_2480 [new locus tag: NWMN_RS14240 ]
  • symbol: NWMN_2480
  • product: hydrolase
  • replicon: chromosome
  • strand: +
  • coordinates: 2726855..2727685
  • length: 831
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGGAAACTTTAGAATTACAAGGCGCTAAATTACGATACCACCAAGTCGGACAAGGACCC
    GTGCTCATCTTTATTCCTGGTGCAAACGGTACCGGAGACATTTTTCTGCCTCTTGCAGAA
    CAGTTAAAAGACCATTTTACTGTTGTAGCCGTTGATCGTCGTGATTATGGAGAAAGCGAG
    TTAACTGAACCACTCCCTGATTCCGCTTCAAACCCTGACAGTGATTATCGTGTCAAACGC
    GACGCACAGGACATTGCCGAACTTGCAAAGTCATTAAGTGATGAACCTGTCTATATATTA
    GGTTCAAGTTCAGGTTCAATCGTTGCGATGCATGTGTTAAAAGATTACCCTGAAGTCGTT
    AAAAAGATTGCATTTCACGAACCACCAATTAATACATTTTTACCAGACAGTACTTATTGG
    AAAGATAAAAATGATGACATTGTGCATCAAATTTTAACAGAAGGCTTAGAAAAAGGCATG
    AAAACATTTGGCGAAACATTAAATATCGCACCAATTGATGCAAAAATGATGTCTCAACCT
    GCTGATACTGAAGAAGGACGTATAGAACAGTACAAACGTACGATGTTCTGGTCAGAATTT
    GAAATTAGACAATATACGCATTCAGATATTACTTTGGATGATTTCACAAAATACAGCGAT
    AAAATCACCCTACTAAATGGGACAGATTCTAGAGGCTCCTTCCCACAAGATGTTAACTTT
    TATATAAATAAAGAAACTGGCATACCTATTGTAGATATTCCAGGCGGTCACTTAGGTTAT
    ATTCAAAAACCTGAAGGCTTTGCTGATGTATTATTAAATATGTGGGGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    831

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_2480 [new locus tag: NWMN_RS14240 ]
  • symbol: NWMN_2480
  • description: hydrolase
  • length: 276
  • theoretical pI: 4.43681
  • theoretical MW: 31005.7
  • GRAVY: -0.426812

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Energy metabolism Other 3-oxoadipate enol-lactonase (TIGR02427; EC 3.1.1.24; HMM-score: 40.6)
    and 7 more
    pyrimidine utilization protein D (TIGR03611; HMM-score: 30.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (TIGR03695; EC 4.2.99.20; HMM-score: 29.7)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Biotin pimelyl-[acyl-carrier protein] methyl ester esterase (TIGR01738; EC 3.1.1.85; HMM-score: 27.9)
    proline-specific peptidase (TIGR01250; HMM-score: 24.2)
    Metabolism Energy metabolism Photosynthesis putative magnesium chelatase accessory protein (TIGR03056; HMM-score: 22.7)
    Metabolism Energy metabolism Other poly(3-hydroxyalkanoate) depolymerase (TIGR02240; EC 3.1.1.-; HMM-score: 18.4)
    prolyl aminopeptidase (TIGR01249; EC 3.4.11.5; HMM-score: 12.1)
  • TheSEED:  
    Predicted hydrolase/acyltransferase
  • PFAM:
    AB_hydrolase (CL0028) Abhydrolase_1; alpha/beta hydrolase fold (PF00561; HMM-score: 58.8)
    Abhydrolase_6; Alpha/beta hydrolase family (PF12697; HMM-score: 47.5)
    and 3 more
    Hydrolase_4; Serine aminopeptidase, S33 (PF12146; HMM-score: 31.2)
    Thioesterase; Thioesterase domain (PF00975; HMM-score: 15.1)
    Esterase; Putative esterase (PF00756; HMM-score: 13.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009449
    • TAT(Tat/SPI): 0.000963
    • LIPO(Sec/SPII): 0.003392
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • METLELQGAKLRYHQVGQGPVLIFIPGANGTGDIFLPLAEQLKDHFTVVAVDRRDYGESELTEPLPDSASNPDSDYRVKRDAQDIAELAKSLSDEPVYILGSSSGSIVAMHVLKDYPEVVKKIAFHEPPINTFLPDSTYWKDKNDDIVHQILTEGLEKGMKTFGETLNIAPIDAKMMSQPADTEEGRIEQYKRTMFWSEFEIRQYTHSDITLDDFTKYSDKITLLNGTDSRGSFPQDVNFYINKETGIPIVDIPGGHLGYIQKPEGFADVLLNMWG

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB (activation) regulon
    SigB(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation [1] [2]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  2. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J Bacteriol: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]