From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS04000 [old locus tag: NWMN_0706 ]
  • pan locus tag?: SAUPAN002641000
  • symbol: NWMN_RS04000
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS04000 [old locus tag: NWMN_0706 ]
  • symbol: NWMN_RS04000
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 792662..792976
  • length: 315
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (792662..792976) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_0706

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGCCTAAAGTTTATGGTTCATTAATCGATACTGAAACACGCTGTCGCCATTATTTTACC
    GAAGAAGATATTATTGCTATTAAATTTAAATGTTGTAATAAATACTATCCATGCTATAAG
    TGCCATAATGAGTTTGAAAAGCACGCCATTAAGCGTTGGTCTGAGCCTTCATTTAACGAA
    AAAGCAATCTTATGCGGTGTATGCAAACACGAATTAACAATCAATGAATATATGATGGTA
    GAGCGTTGTCCAAATTGCCAATCTCGGTTTAACAATCGCTGTAAATATCACTATCATATT
    TATTTTGAAATTTAA
    60
    120
    180
    240
    300
    315

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS04000 [old locus tag: NWMN_0706 ]
  • symbol: NWMN_RS04000
  • description: hypothetical protein
  • length: 104
  • theoretical pI: 8.09137
  • theoretical MW: 12723.7
  • GRAVY: -0.645192

Function[edit | edit source]

  • TIGRFAM:
    MJ0042 family finger-like domain (TIGR02098; HMM-score: 11)
    and 1 more
    Genetic information processing Protein fate Protein modification and repair hydrogenase nickel insertion protein HypA (TIGR00100; HMM-score: 7.4)
  • TheSEED: data available for COL, N315, NCTC8325
  • PFAM:
    no clan defined zf-CHY; CHY zinc finger (PF05495; HMM-score: 48.8)
    and 4 more
    Zn_Beta_Ribbon (CL0167) DZR; Double zinc ribbon (PF12773; HMM-score: 16.1)
    no clan defined HypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 13.3)
    Evr1_Alr; Erv1 / Alr family (PF04777; HMM-score: 7.1)
    Zn_Beta_Ribbon (CL0167) DUF1451; Zinc-ribbon containing domain (PF07295; HMM-score: 6.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.183656
    • TAT(Tat/SPI): 0.000783
    • LIPO(Sec/SPII): 0.009195
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MPKVYGSLIDTETRCRHYFTEEDIIAIKFKCCNKYYPCYKCHNEFEKHAIKRWSEPSFNEKAILCGVCKHELTINEYMMVERCPNCQSRFNNRCKYHYHIYFEI

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]