From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS08875 [old locus tag: NWMN_1582 ]
  • pan locus tag?: SAUPAN004312000
  • symbol: NWMN_RS08875
  • pan gene symbol?: mutM
  • synonym:
  • product: DNA-formamidopyrimidine glycosylase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS08875 [old locus tag: NWMN_1582 ]
  • symbol: NWMN_RS08875
  • product: DNA-formamidopyrimidine glycosylase
  • replicon: chromosome
  • strand: -
  • coordinates: 1749740..1750612
  • length: 873
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_009641 (1749740..1750612) NCBI
  • BioCyc:
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGCCCGAATTACCAGAAGTAGAACATGTAAAAAGAGGAATTGAACCCTACGTTATAAAT
    CAAAAAATTGAACACGTTATATTTTCGGATAAAGTAATCGAAGGTAAAGCTCAAGGCAAG
    GAAACAATTATAAAAGGAATTGAATTAGATACTTTTAAAACTTTATCGGAAGGCTATACC
    ATTACAAATGTAGAACGAAGAAGTAAATATATCGTTTTTCAGCTAGATAATAAACGAGAA
    CAACGTACATTAATTAGTCATTTAGGTATGGCGGGCGGTTTTTTCATTGTAGATGAACTT
    GAAGATATTATGATACCTAATTATCGTAAGCATTGGCATGTTATTTTTGAGTTGTCAAAT
    GACAAAAAGTTAATTTATTCAGATATACGTCGTTTTGGAGAAATTAGAAATGTTGCGTCT
    GTAGCATCTTATCCTTCATTTTTAGAAATAGCGCCTGAACCTTTTTCAAATGAAGCATTG
    ACGTATTATTTAAATCGAATTCATCAACAGTCTAATAAGAATAAACCAATCAAACAAGTG
    ATTTTGGATCATAAAGTAATCGCAGGTTGTGGAAATATTTACGCATGTGAAGCGTTGTTT
    CGTGCAGGTGTTTTACCAGATAAAAAAGTAAAAGACTTAACACACCAACAACAAGAAATG
    GTTTTTTATTATGTTAGAGAAGTACTAGAAGAAGGTATTAAATATGGCGGTACAAGTATT
    TCAGATTATCGTCATGCTGATGGAAAAACTGGTGAGATGCAATTGCATCTTAATGTATAT
    AAGCAGCCGGTATGCAAAGTGTGTGGAAGTCAAATTGAAACAAAAATCATCGCGACAAGA
    AATAGTCATTATTGTCCAGTATGTCAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    873

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS08875 [old locus tag: NWMN_1582 ]
  • symbol: NWMN_RS08875
  • description: DNA-formamidopyrimidine glycosylase
  • length: 290
  • theoretical pI: 8.12881
  • theoretical MW: 33411.2
  • GRAVY: -0.39069

Function[edit | edit source]

  • reaction:
    EC 3.2.2.23?  ExPASy
    DNA-formamidopyrimidine glycosylase Hydrolysis of DNA containing ring-opened 7-methylguanine residues, releasing 2,6-diamino-4-hydroxy-5-(N-methyl)formamidopyrimidine
    EC 4.2.99.18?  ExPASy
    DNA-(apurinic or apyrimidinic site) lyase The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate
  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA-formamidopyrimidine glycosylase (TIGR00577; EC 3.2.2.23; HMM-score: 235.5)
    and 1 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS13 (TIGR03631; HMM-score: 15.1)
  • TheSEED:
  • PFAM:
    no clan defined Fapy_DNA_glyco; Formamidopyrimidine-DNA glycosylase N-terminal domain (PF01149; HMM-score: 99.2)
    and 3 more
    H2TH (CL0303) H2TH; Formamidopyrimidine-DNA glycosylase H2TH domain (PF06831; HMM-score: 70.1)
    Zn_Beta_Ribbon (CL0167) zf-FPG_IleRS; Zinc finger found in FPG and IleRS (PF06827; HMM-score: 24.7)
    H2TH (CL0303) FbpA; Fibronectin-binding protein A N-terminus (FbpA) (PF05833; HMM-score: 16.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005618
    • TAT(Tat/SPI): 0.000165
    • LIPO(Sec/SPII): 0.000521
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 447037196 NCBI
  • RefSeq: WP_001114452 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MPELPEVEHVKRGIEPYVINQKIEHVIFSDKVIEGKAQGKETIIKGIELDTFKTLSEGYTITNVERRSKYIVFQLDNKREQRTLISHLGMAGGFFIVDELEDIMIPNYRKHWHVIFELSNDKKLIYSDIRRFGEIRNVASVASYPSFLEIAPEPFSNEALTYYLNRIHQQSNKNKPIKQVILDHKVIAGCGNIYACEALFRAGVLPDKKVKDLTHQQQEMVFYYVREVLEEGIKYGGTSISDYRHADGKTGEMQLHLNVYKQPVCKVCGSQIETKIIATRNSHYCPVCQK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]