From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1736 [new locus tag: SACOL_RS08875 ]
  • pan locus tag?: SAUPAN004312000
  • symbol: fpg
  • pan gene symbol?: mutM
  • synonym:
  • product: formamidopyrimidine-DNA glycosylase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1736 [new locus tag: SACOL_RS08875 ]
  • symbol: fpg
  • product: formamidopyrimidine-DNA glycosylase
  • replicon: chromosome
  • strand: -
  • coordinates: 1766901..1767773
  • length: 873
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGCCCGAATTACCAGAAGTAGAACATGTAAAAAGAGGAATTGAACCCTACGTTATAAAT
    CAAAAAATTGAACACGTTATATTTTCGGATAAAGTAATCGAAGGTAAAGCTCAAGGCAAG
    GAAACAATTATAAAAGGAATTGAATTAGATACTTTTAAAACTTTATCGGAAGGCTATACC
    ATTACAAATGTAGAACGAAGAAGTAAATATATCGTTTTTCAGCTAGATAATAAACGAGAA
    CAACGTACATTAATTAGTCATTTAGGTATGGCGGGCGGTTTTTTCATTGTAGATGAACTT
    GAAGATATTATGATACCTAATTATCGTAAGCATTGGCATGTTATTTTTGAGTTGTCAAAT
    GACAAAAAGTTAATTTATTCAGATATACGTCGTTTTGGAGAAATTAGAAATGTTGCGTCT
    GTAGCATCTTATCCTTCATTTTTAGAAATAGCGCCTGAACCTTTTTCAAATGAAGCATTG
    ACGTATTATTTAAATCGAATTCATCAACAGTCTAATAAGAATAAACCAATCAAACAAGTG
    ATTTTGGATCATAAAGTAATCGCAGGTTGTGGAAATATTTACGCATGTGAAGCGTTGTTT
    CGTGCAGGTGTTTTACCAGATAAAAAAGTAAAAGACTTAACACACCAACAACAAGAAATG
    GTTTTTTATTATGTTAGAGAAGTACTAGAAGAAGGTATTAAATATGGCGGTACAAGTATT
    TCAGATTATCGTCATGCTGATGGAAAAACTGGTGAGATGCAATTGCATCTTAATGTATAT
    AAGCAGCCGGTATGCAAAGTGTGTGGAAGTCAAATTGAAACAAAAATCATCGCGACAAGA
    AATAGTCATTATTGTCCAGTATGTCAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    873

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1736 [new locus tag: SACOL_RS08875 ]
  • symbol: Fpg
  • description: formamidopyrimidine-DNA glycosylase
  • length: 290
  • theoretical pI: 8.12881
  • theoretical MW: 33411.2
  • GRAVY: -0.39069

Function[edit | edit source]

  • reaction:
    EC 3.2.2.23?  ExPASy
    DNA-formamidopyrimidine glycosylase Hydrolysis of DNA containing ring-opened 7-methylguanine residues, releasing 2,6-diamino-4-hydroxy-5-(N-methyl)formamidopyrimidine
    EC 4.2.99.18?  ExPASy
    DNA-(apurinic or apyrimidinic site) lyase The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate
  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA-formamidopyrimidine glycosylase (TIGR00577; EC 3.2.2.23; HMM-score: 235.5)
    and 1 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein uS13 (TIGR03631; HMM-score: 15.1)
  • TheSEED:  
    DNA Metabolism DNA repair DNA Repair Base Excision  Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)
  • PFAM:
    no clan defined Fapy_DNA_glyco; Formamidopyrimidine-DNA glycosylase N-terminal domain (PF01149; HMM-score: 99.2)
    and 3 more
    H2TH (CL0303) H2TH; Formamidopyrimidine-DNA glycosylase H2TH domain (PF06831; HMM-score: 70.1)
    Zn_Beta_Ribbon (CL0167) zf-FPG_IleRS; Zinc finger found in FPG and IleRS (PF06827; HMM-score: 24.7)
    H2TH (CL0303) FbpA; Fibronectin-binding protein A N-terminus (FbpA) (PF05833; HMM-score: 16.2)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005618
    • TAT(Tat/SPI): 0.000165
    • LIPO(Sec/SPII): 0.000521
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MPELPEVEHVKRGIEPYVINQKIEHVIFSDKVIEGKAQGKETIIKGIELDTFKTLSEGYTITNVERRSKYIVFQLDNKREQRTLISHLGMAGGFFIVDELEDIMIPNYRKHWHVIFELSNDKKLIYSDIRRFGEIRNVASVASYPSFLEIAPEPFSNEALTYYLNRIHQQSNKNKPIKQVILDHKVIAGCGNIYACEALFRAGVLPDKKVKDLTHQQQEMVFYYVREVLEEGIKYGGTSISDYRHADGKTGEMQLHLNVYKQPVCKVCGSQIETKIIATRNSHYCPVCQK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3]
    quantitative data / protein copy number per cell: 89 [4]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]