Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_RS14265 [old locus tag: NWMN_2485 ]
- pan locus tag?: SAUPAN006265000
- symbol: NWMN_RS14265
- pan gene symbol?: lapT2
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_RS14265 [old locus tag: NWMN_2485 ]
- symbol: NWMN_RS14265
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2731878..2732246
- length: 369
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGTCGAATAAACTGGATGAAATCAATAAAATAATCACAGCGAAACATGAGCAAATGGAT
GACTTATATGATGAAAAGCGAGAGGTTAAAGCATTGATAGATGAAAGTGATGCGCTTAAT
CATTCGATAGATCAATTATATCAACATTTAGGTGAGCGTTATTATAGTAGCAATATGGCT
AGTCGTATGGAACAGTTCCGCGATGAATTTCATTTTGCGAAACGACGTTCAACGGAAGCG
TTATACGAGCAGCAACAGCAAATTCAACATGGCATTCGTAAAGTGGAAGAAGAGATGATT
GACTTGGAAATGCGAAGGAATGTTGAAATTGAGACGGTGACAAAGGAGGAAAATAAATGG
AAACAATAG60
120
180
240
300
360
369
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_RS14265 [old locus tag: NWMN_2485 ]
- symbol: NWMN_RS14265
- description: hypothetical protein
- length: 122
- theoretical pI: 4.93014
- theoretical MW: 14822.4
- GRAVY: -1.18279
⊟Function[edit | edit source]
- TIGRFAM: conserved hypothetical protein (TIGR02231; HMM-score: 12.8)Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides polysaccharide chain length determinant protein, PEP-CTERM locus subfamily (TIGR03007; HMM-score: 11.9)and 2 moreCellular processes Adaptations to atypical conditions phage shock protein C (TIGR02978; HMM-score: 7.7)DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 5.2)
- TheSEED: see NWMN_2485
- PFAM: no clan defined DUF3958; Protein of unknown function (DUF3958) (PF13125; HMM-score: 26.5)and 8 moreFAD-oxidase_C (CL0277) Lact-deh-memb; D-lactate dehydrogenase, membrane binding (PF09330; HMM-score: 15.8)no clan defined CCDC90-like; Coiled-coil domain-containing protein 90-like (PF07798; HMM-score: 14.7)T3SS-Chaperone (CL0419) YscO-like; YscO-like protein (PF16789; HMM-score: 14.3)6_Hairpin (CL0059) Beta-AFase-like_GH127_cat; Beta-L-arabinofuranosidase, GH127 catalytic domain (PF07944; HMM-score: 13.4)no clan defined YabA; Initiation control protein YabA (PF06156; HMM-score: 11.4)NBD94; Nucleotide-Binding Domain 94 of RH (PF16830; HMM-score: 10.9)UPF0242; Uncharacterised protein family (UPF0242) N-terminus (PF06785; HMM-score: 9.7)DUF7365; Coiled-coil region of unknown function (DUF7365) (PF24073; HMM-score: 7.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.5926
- Cytoplasmic Membrane Score: 0.0888
- Cell wall & surface Score: 0.0062
- Extracellular Score: 0.3123
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002242
- TAT(Tat/SPI): 0.001165
- LIPO(Sec/SPII): 0.000308
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSNKLDEINKIITAKHEQMDDLYDEKREVKALIDESDALNHSIDQLYQHLGERYYSSNMASRMEQFRDEFHFAKRRSTEALYEQQQQIQHGIRKVEEEMIDLEMRRNVEIETVTKEENKWKQ
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]