From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_RS14270 [old locus tag: NWMN_2486 ]
  • pan locus tag?: SAUPAN006266000
  • symbol: NWMN_RS14270
  • pan gene symbol?: lapT1
  • synonym:
  • product: TIGR04197 family type VII secretion effector

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_RS14270 [old locus tag: NWMN_2486 ]
  • symbol: NWMN_RS14270
  • product: TIGR04197 family type VII secretion effector
  • replicon: chromosome
  • strand: -
  • coordinates: 2732261..2732539
  • length: 279
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_009641 (2732261..2732539) NCBI
  • BioCyc:
  • MicrobesOnline: see NWMN_2486

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGATGAGTACAGTTCAAAGTGATATTTTTAAGACCAATAGTGCATCATCATCTATTAAA
    AGCGCTGTTGAAACATGTAATAATGTGTCGAAACCGGATAAAGATGAAAGTACAACAGTA
    AGTGGAAATAATAATGCTCATAGTGTGATAGATGATTTGATGAGTAAGAATCAATCTGTT
    GCTGAAGCAATACGAACTGCGAGCGATAATATACAAAAAGTTGGTGAGGCTTTTGACCAA
    ACTGACGTAATGATTGGTAATGAAATTGGTAAAAATTAA
    60
    120
    180
    240
    279


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_RS14270 [old locus tag: NWMN_2486 ]
  • symbol: NWMN_RS14270
  • description: TIGR04197 family type VII secretion effector
  • length: 92
  • theoretical pI: 4.35593
  • theoretical MW: 9798.67
  • GRAVY: -0.56087

Function[edit | edit source]

  • TIGRFAM:
    type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 71)
  • TheSEED: see NWMN_2486
  • PFAM:
    Prefoldin (CL0200) Prefoldin; Prefoldin subunit (PF02996; HMM-score: 14.9)
    no clan defined DASH_Duo1; DASH complex subunit Duo1 (PF08651; HMM-score: 12.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.0004
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.9991
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.040638
    • TAT(Tat/SPI): 0.005333
    • LIPO(Sec/SPII): 0.037752
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MMSTVQSDIFKTNSASSSIKSAVETCNNVSKPDKDESTTVSGNNNAHSVIDDLMSKNQSVAEAIRTASDNIQKVGEAFDQTDVMIGNEIGKN

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]