From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0215 [new locus tag: SA_RS01260 ]
  • pan locus tag?: SAUPAN001076000
  • symbol: SA0215
  • pan gene symbol?: hptR
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0215 [new locus tag: SA_RS01260 ]
  • symbol: SA0215
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 255006..255764
  • length: 759
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGTTTAAGGTAGTTATTTGTGATGATGAACGAATTATTCGAGAAGGTTTAAAGCAAATC
    ATTCCTTGGGGAGACTATCATTTCAATACAATATACACTGCTAAAGATGGTGTTGAAGCA
    TTATCACTAATTCAACAACATCAGCCAGAATTAGTAATTACTGATATTCGTATGCCACGT
    AAAAATGGCGTCGATTTACTCAATGATATTGCGCTTCTAGATTGTAATGTCATCATATTA
    TCGAGTTACGATGACTTTGAATATATGAAAGCCGGCATTCAACATCATGTTCTTGATTAT
    TTATTAAAACCAGTAGACCATGCACAATTAGAAGTTATTTTAGGAAGACTTGTCCGTACC
    TTATTAGAGCAACAATCACAGAACGGCCGTAGCTTAGCATCTTGTCATGATGCCTTCCAA
    CCACTATTAAAAGTAGAATACGATGATTATTATGTAAATCAGATTGTTGATCAAATTAAG
    CAATCTTATCAAACGAAAGTGACTGTTTCAGATTTAATTCAACATATCGATGTTAGTGAA
    TCGTATGCGATGCGAACATTTAAAGATCATGTTGGTATTACAATTGTCGATTATTTAAAT
    CGCTATCGTATTTTACAATCTCTGCAATTGTTAGATCGACATTACAAACACTATGAAATT
    GCAGACAAAGTAGGCTTTTCAGAGTATAAAATGTTTAGCTATCATTTTAAAAAATATTTA
    CAAATGTCGCCAAGTGATTATTGTAAGCAAGCTAAATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    759

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0215 [new locus tag: SA_RS01260 ]
  • symbol: SA0215
  • description: hypothetical protein
  • length: 252
  • theoretical pI: 6.4326
  • theoretical MW: 29574.7
  • GRAVY: -0.289286

Function[edit | edit source]

  • TIGRFAM:
    YSIRK-targeted surface antigen transcriptional regulator (TIGR04094; HMM-score: 61.7)
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 54.2)
    Signal transduction Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 54.2)
    Signal transduction Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 54.2)
    Cellular processes Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 50.6)
    and 8 more
    Signal transduction Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 38.1)
    Signal transduction Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 35.1)
    Signal transduction Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 29.7)
    Signal transduction Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 29.7)
    Signal transduction Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 19.4)
    4-hydroxyphenylacetate catabolism regulatory protein HpaA (TIGR02297; HMM-score: 15.4)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Menaquinone and ubiquinone 3-demethylubiquinone-9 3-O-methyltransferase (TIGR01983; EC 2.1.1.64; HMM-score: 13.1)
    RNA polymerase sigma-70 factor, Planctomycetaceae-specific subfamily 1 (TIGR02984; HMM-score: 12.5)
  • TheSEED:  
    DNA-binding response regulator, AraC family
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 85.5)
    and 2 more
    HTH (CL0123) HTH_18; Helix-turn-helix domain (PF12833; HMM-score: 58.3)
    HTH_AraC; Bacterial regulatory helix-turn-helix proteins, AraC family (PF00165; HMM-score: 47.9)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00146
    • TAT(Tat/SPI): 0.000078
    • LIPO(Sec/SPII): 0.000234
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MFKVVICDDERIIREGLKQIIPWGDYHFNTIYTAKDGVEALSLIQQHQPELVITDIRMPRKNGVDLLNDIALLDCNVIILSSYDDFEYMKAGIQHHVLDYLLKPVDHAQLEVILGRLVRTLLEQQSQNGRSLASCHDAFQPLLKVEYDDYYVNQIVDQIKQSYQTKVTVSDLIQHIDVSESYAMRTFKDHVGITIVDYLNRYRILQSLQLLDRHYKHYEIADKVGFSEYKMFSYHFKKYLQMSPSDYCKQAK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

Joo Youn Park, Jong Wan Kim, Bo Youn Moon, Juyeun Lee, Ye Ji Fortin, Frank W Austin, Soo-Jin Yang, Keun Seok Seo
Characterization of a novel two-component regulatory system, HptRS, the regulator for the hexose phosphate transport system in Staphylococcus aureus.
Infect Immun: 2015, 83(4);1620-8
[PubMed:25644013] [WorldCat.org] [DOI] (I p)