From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2100 [new locus tag: SA_RS12070 ]
  • pan locus tag?: SAUPAN005782000
  • symbol: SA2100
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2100 [new locus tag: SA_RS12070 ]
  • symbol: SA2100
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2360658..2361434
  • length: 777
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAGAAGAATTTCAAGTTACGCATTTCAACGCTACTATTGATAGTTATTTTAGTTGTT
    TTTGCTGTATTACTCATCGTGAATGAAACTAAATTGTTTAAAAATGATGTGAATTACTCT
    TTTGATGAGGCTGTTTCAATGCAACAAGGGAAAGGTATTGTACAGACAAAAGAAGAGGAT
    GGTAAATTTGTTGAAGCAAATAATAATGAAATTGCTAAAGCAATGACTATTTCACATAAA
    GACAATGATATGAAGTATATGGATATCACAGAAAAAGTGCCAATGTCGGAATCTGAAGTT
    AACCAATTGCTAAAAGGTAAGGGGATTTTAGAAAATCGAGGGAAAGTTTTTCTAGAAGCT
    CAAGAAAAATATGAGGTTAATGTCATTTATCTTGTTAGCCATGCATTAGTAGAAACAGGT
    AACGGCAAATCAGAATTAGCAAAAGGCATTAAAGATGGGAAAAAACGCTATTACAACTTT
    TTTGGTATAGGAGCATTCGATAGTAGTGCTGTTCGTAGTGGGAAAAGTTATGCTGAAAAG
    GAACAATGGACATCACCAGATAAGGCGATTATTGGTGGTGCAAAGTTCATTCGTAATGAA
    TATTTTGAAAACAATCAACTGAATTTATATCAAATGCGATGGAATCCAGAAAATCCTGCG
    CAACATCAATATGCGAGTGACATTCGATGGGCAGATAAAATTGCCAAATTAATGGATAAA
    TCCTATAAGCAGTTTGGTATAAAGAAAGATGATATTAGACAAACATATTATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    777

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2100 [new locus tag: SA_RS12070 ]
  • symbol: SA2100
  • description: hypothetical protein
  • length: 258
  • theoretical pI: 9.60613
  • theoretical MW: 29671.8
  • GRAVY: -0.555039

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:  
    Cell Wall and Capsule Cell Wall and Capsule - no subcategory Murein Hydrolases  N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)
    and 4 more
    Recycling of Peptidoglycan Amino Acids  N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)
    Regulation and Cell signaling Quorum sensing and biofilm formation Biofilm formation in Staphylococcus  Bifunctional autolysin Atl
    Virulence, Disease and Defense Adhesion Adhesins in Staphylococcus  Bifunctional autolysin Atl
    Raj MurE  N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)
  • PFAM:
    Lysozyme (CL0037) Glucosaminidase; Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase (PF01832; HMM-score: 63.7)
    and 2 more
    no clan defined Dcc1; Sister chromatid cohesion protein Dcc1 (PF09724; HMM-score: 16.7)
    Sigma_reg_N; Sigma factor regulator N-terminal (PF13800; HMM-score: 13)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.419066
    • TAT(Tat/SPI): 0.000696
    • LIPO(Sec/SPII): 0.031158
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKNFKLRISTLLLIVILVVFAVLLIVNETKLFKNDVNYSFDEAVSMQQGKGIVQTKEEDGKFVEANNNEIAKAMTISHKDNDMKYMDITEKVPMSESEVNQLLKGKGILENRGKVFLEAQEKYEVNVIYLVSHALVETGNGKSELAKGIKDGKKRYYNFFGIGAFDSSAVRSGKSYAEKEQWTSPDKAIIGGAKFIRNEYFENNQLNLYQMRWNPENPAQHQYASDIRWADKIAKLMDKSYKQFGIKKDDIRQTYYK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SA2100 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]