Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA2286 [new locus tag: SA_RS13110 ]
- pan locus tag?: SAUPAN006109000
- symbol: sarT
- pan gene symbol?: sarT
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA2286 [new locus tag: SA_RS13110 ]
- symbol: sarT
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2564122..2564481
- length: 360
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1125213 NCBI
- RefSeq: NP_375610 NCBI
- BioCyc: see SA_RS13110
- MicrobesOnline: 104636 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301TTGATGAATGATTTGAAAAGCAAGAGCAATATTAAATTAATGAAAAGAGTATTAACTACA
TATGAGCTGCGTAAATATTTAAAAAAATATTTTTGTCTTACATTAGATAATTATTTAGTA
TTAGCATATTTAGATGTATTTAAAAATGATGAAGGTAAATATTTTATGAGAGACATTATA
AGTTATATCGGTATAGACCAATCTAGAATTGTTAAAAGCGTAAAAGAATTATCAAAAAAG
GGTTACTTGAATAAATGTAGAGACCCACATGATAGTAGAAATGTAATCATTGTTGTTTCT
GTAAAACAACACAATTATATTAAAAATCTTTTGAGTGAAATAAATATTAATGAAACATAA60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA2286 [new locus tag: SA_RS13110 ]
- symbol: SarT
- description: hypothetical protein
- length: 119
- theoretical pI: 9.99051
- theoretical MW: 14133.5
- GRAVY: -0.37395
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 116.1)and 1 moreRegulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 13.9)
- TheSEED :
- Transcriptional regulator SarT (Staphylococcal accessory regulator T)
- PFAM: HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 53.5)and 6 moreMarR_2; MarR family (PF12802; HMM-score: 32.4)HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 27.3)MarR; MarR family (PF01047; HMM-score: 20.6)TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 18.8)DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 16.5)no clan defined ELF; ELF protein (PF03317; HMM-score: 14.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.67
- Cytoplasmic Membrane Score: 0.01
- Cellwall Score: 0.15
- Extracellular Score: 0.17
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.7255
- Cytoplasmic Membrane Score: 0.0259
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.2483
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.001796
- TAT(Tat/SPI): 0.000198
- LIPO(Sec/SPII): 0.00048
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MMNDLKSKSNIKLMKRVLTTYELRKYLKKYFCLTLDNYLVLAYLDVFKNDEGKYFMRDIISYIGIDQSRIVKSVKELSKKGYLNKCRDPHDSRNVIIVVSVKQHNYIKNLLSEININET
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]