From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA2286 [new locus tag: SA_RS13110 ]
  • pan locus tag?: SAUPAN006109000
  • symbol: sarT
  • pan gene symbol?: sarT
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA2286 [new locus tag: SA_RS13110 ]
  • symbol: sarT
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2564122..2564481
  • length: 360
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    TTGATGAATGATTTGAAAAGCAAGAGCAATATTAAATTAATGAAAAGAGTATTAACTACA
    TATGAGCTGCGTAAATATTTAAAAAAATATTTTTGTCTTACATTAGATAATTATTTAGTA
    TTAGCATATTTAGATGTATTTAAAAATGATGAAGGTAAATATTTTATGAGAGACATTATA
    AGTTATATCGGTATAGACCAATCTAGAATTGTTAAAAGCGTAAAAGAATTATCAAAAAAG
    GGTTACTTGAATAAATGTAGAGACCCACATGATAGTAGAAATGTAATCATTGTTGTTTCT
    GTAAAACAACACAATTATATTAAAAATCTTTTGAGTGAAATAAATATTAATGAAACATAA
    60
    120
    180
    240
    300
    360

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA2286 [new locus tag: SA_RS13110 ]
  • symbol: SarT
  • description: hypothetical protein
  • length: 119
  • theoretical pI: 9.99051
  • theoretical MW: 14133.5
  • GRAVY: -0.37395

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 116.1)
    and 1 more
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 13.9)
  • TheSEED  :
    • Transcriptional regulator SarT (Staphylococcal accessory regulator T)
  • PFAM:
    HTH (CL0123) Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 53.5)
    and 6 more
    MarR_2; MarR family (PF12802; HMM-score: 32.4)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 27.3)
    MarR; MarR family (PF01047; HMM-score: 20.6)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 18.8)
    DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 16.5)
    no clan defined ELF; ELF protein (PF03317; HMM-score: 14.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.7255
    • Cytoplasmic Membrane Score: 0.0259
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.2483
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001796
    • TAT(Tat/SPI): 0.000198
    • LIPO(Sec/SPII): 0.00048
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MMNDLKSKSNIKLMKRVLTTYELRKYLKKYFCLTLDNYLVLAYLDVFKNDEGKYFMRDIISYIGIDQSRIVKSVKELSKKGYLNKCRDPHDSRNVIIVVSVKQHNYIKNLLSEININET

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]