Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0277 [new locus tag: SACOL_RS01405 ]
- pan locus tag?: SAUPAN001185000
- symbol: SACOL0277
- pan gene symbol?: esxC
- synonym: esaC
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0277 [new locus tag: SACOL_RS01405 ]
- symbol: SACOL0277
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 319760..320152
- length: 393
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236665 NCBI
- RefSeq: YP_185172 NCBI
- BioCyc: see SACOL_RS01405
- MicrobesOnline: 911750 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAATTTTAATGATATTGAAACAATGGTTAAGTCGAAATTTAAAGATATTAAAAAGCAT
GCTGAAGAGATTGCGCATGAAATTGAAGTTCGTTCTGGATATTTAAGAAAAGCTGAACAA
TATAAGCGATTAGAATTTAATTTGAGTTTTGCACTAGATGATATTGAAAGCACAGCAAAG
GACGTACAAACTGCAAAATCTAGTGCTAATAAGGACAGTGTAACTGTTAAGGGAAAGGCG
CCCAATACGTTATATATTGAAAAAAGAAATTTGATGAAACAAAAGCTTGAAATGTTGGGT
GAAGATATCGATAAAAATAAAGAATCCCTCCAAAAAGCTAAGGAAATTGCTGGCGAAAAG
GCAAGTGAATATTTTAATAAAGCAATGAATTAA60
120
180
240
300
360
393
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0277 [new locus tag: SACOL_RS01405 ]
- symbol: SACOL0277
- description: hypothetical protein
- length: 130
- theoretical pI: 9.29158
- theoretical MW: 14936.9
- GRAVY: -0.885385
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- EsaC protein within ESAT-6 gene cluster (S.aureus type)
- PFAM: no clan defined DUF745; Protein of unknown function (DUF745) (PF05335; HMM-score: 16.7)CHD1-like_C; Chromodomain-helicase-DNA-binding protein 1-like, C-terminal (PF13907; HMM-score: 14.6)and 3 moreOML_zippers (CL0590) LPP; Lipoprotein leucine-zipper (PF04728; HMM-score: 11.6)no clan defined ISG65-75; Invariant surface glycoprotein (PF11727; HMM-score: 9.3)LsmAD; LsmAD domain (PF06741; HMM-score: 7.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0.3082
- Cytoplasmic Membrane Score: 0.0037
- Cell wall & surface Score: 0.0017
- Extracellular Score: 0.6864
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005672
- TAT(Tat/SPI): 0.001159
- LIPO(Sec/SPII): 0.000577
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNFNDIETMVKSKFKDIKKHAEEIAHEIEVRSGYLRKAEQYKRLEFNLSFALDDIESTAKDVQTAKSSANKDSVTVKGKAPNTLYIEKRNLMKQKLEMLGEDIDKNKESLQKAKEIAGEKASEYFNKAMN
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)