Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0280 [new locus tag: SACOL_RS01420 ]
- pan locus tag?: SAUPAN001188000
- symbol: SACOL0280
- pan gene symbol?: esxD
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0280 [new locus tag: SACOL_RS01420 ]
- symbol: SACOL0280
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 321156..321473
- length: 318
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236668 NCBI
- RefSeq: YP_185175 NCBI
- BioCyc:
- MicrobesOnline: 911753 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACGTTGAGTGGAAAAATTAGTGTTAAAGCTGAAACGATTGCACATGTTGTAAAAGAA
TTGGAAAGCATAAGTCAAAAGTATGATGAAATAGCTCAAAACTTTGGAAAAATAGCGCAA
TTAAATTACTACAGTAGTGAAAAAGCTGCACATTCTATGGAAAATGGCTATAGTAGTGCT
GCAACAGTCATTAGTGGTCTCAAAGGTCCATTGAGTACACTCGGTGGTGGCGTCATGAAT
TCAGCACAAAAGTTCTTTGAAGCAGATGAACATTGGGGTACGGAATTTGCCAAGCTTTAC
TATAATATTGAGGGATAG60
120
180
240
300
318
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0280 [new locus tag: SACOL_RS01420 ]
- symbol: SACOL0280
- description: hypothetical protein
- length: 105
- theoretical pI: 5.61271
- theoretical MW: 11414.7
- GRAVY: -0.28381
⊟Function[edit | edit source]
- TIGRFAM: WXG100 family type VII secretion target (TIGR03930; HMM-score: 13)
- TheSEED :
- FIG01108475: hypothetical protein
- PFAM: no clan defined Dynactin_p22; Dynactin subunit p22 (PF07426; HMM-score: 13)DUF5098; Domain of unknown function (DUF5098) (PF17023; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011527
- TAT(Tat/SPI): 0.001116
- LIPO(Sec/SPII): 0.001213
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTLSGKISVKAETIAHVVKELESISQKYDEIAQNFGKIAQLNYYSSEKAAHSMENGYSSAATVISGLKGPLSTLGGGVMNSAQKFFEADEHWGTEFAKLYYNIEG
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Mark Anderson, Khaled A Aly, Yi-Hsing Chen, Dominique Missiakas
Secretion of atypical protein substrates by the ESAT-6 secretion system of Staphylococcus aureus.
Mol Microbiol: 2013, 90(4);734-43
[PubMed:24033479] [WorldCat.org] [DOI] (I p)