From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0282 [new locus tag: SACOL_RS01430 ]
  • pan locus tag?: SAUPAN001199000
  • symbol: SACOL0282
  • pan gene symbol?: esaG1
  • synonym: esaG
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0282 [new locus tag: SACOL_RS01430 ]
  • symbol: SACOL0282
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 323338..323829
  • length: 492
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGACATTTGAAGAGAAGCTTAGCAAAATATACAATGAAATTGCGAATGAGATTAGCAGT
    ATGATACCGGTAGAGTGGGAAAAAGTATATACAATGGCTTATATAGATGATGGAGGAGGT
    GAAGTATTCTTTAATTATACTAAACCAGGTAGTGATGACTTGAATTATTACACCAATATA
    CCTAAGGAGTATAACATTTCTGTGCAAGTATTTGATGATTTATGGATGGATTTATATGAT
    TTATTTGAGGAGTTAAGAGATTTATTTAAAGAAGAAGATTTAGAACCATGGACATCATGC
    GAATTTGATTTTACAAGAGAAGGTGAATTAAAAGTTTCATTTGATTATATTGATTGGATA
    AATTCAGAATTTGGTCAAATAGGTCGACAAAATTACTATAAGTATAGAAAATTTGGAATT
    TTACCAGAAACGGAATATGAAATTAATAAAGTTAAAGAAATCGAGCAATATATTAAAGAG
    CTAGAAGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    492

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0282 [new locus tag: SACOL_RS01430 ]
  • symbol: SACOL0282
  • description: hypothetical protein
  • length: 163
  • theoretical pI: 3.90747
  • theoretical MW: 19731.8
  • GRAVY: -0.668098

Function[edit | edit source]

  • TIGRFAM:
    conserved hypothetical protein (TIGR01741; HMM-score: 257.5)
  • TheSEED  :
    • Repetitive hypothetical protein near ESAT cluster, SA0282 homolog
    Membrane Transport Protein secretion system, Type VII ESAT-6 proteins secretion system in Firmicutes  Repetitive hypothetical protein near ESAT cluster, SA0282 homolog
  • PFAM:
    no clan defined YezG-like; Immunity protein YezG-like (PF04634; HMM-score: 194.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8207
    • Cytoplasmic Membrane Score: 0.1037
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0753
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009447
    • TAT(Tat/SPI): 0.000426
    • LIPO(Sec/SPII): 0.000752
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTFEEKLSKIYNEIANEISSMIPVEWEKVYTMAYIDDGGGEVFFNYTKPGSDDLNYYTNIPKEYNISVQVFDDLWMDLYDLFEELRDLFKEEDLEPWTSCEFDFTREGELKVSFDYIDWINSEFGQIGRQNYYKYRKFGILPETEYEINKVKEIEQYIKELEE

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 1244 [4]
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 46.78 h [5]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

Zhenping Cao, M Guillermina Casabona, Holger Kneuper, James D Chalmers, Tracy Palmer
The type VII secretion system of Staphylococcus aureus secretes a nuclease toxin that targets competitor bacteria.
Nat Microbiol: 2016, 2;16183
[PubMed:27723728] [WorldCat.org] [DOI] (I e)