From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0420 [new locus tag: SACOL_RS02115 ]
  • pan locus tag?: SAUPAN001892000
  • symbol: SACOL0420
  • pan gene symbol?:
  • synonym:
  • product: Cro/CI family transcriptional regulator

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0420 [new locus tag: SACOL_RS02115 ]
  • symbol: SACOL0420
  • product: Cro/CI family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 425482..425685
  • length: 204
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    GTGCGTAATCGATTGAAAGAATTACGAGCACGAGATGGCTTAAACCAAACGCAACTTGCT
    AAACAAGCGGGCGTTTCAAGACAAACCATATCGCTAATTGAGCGAAACAATTTTATGCCA
    TCAGTATTAACGGCAATAAAAATTGCTCGCATTTTCAATGAAACGGTGGAAACTGTTTTT
    ATTATTGAGGAGGATGAGGCATGA
    60
    120
    180
    204


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0420 [new locus tag: SACOL_RS02115 ]
  • symbol: SACOL0420
  • description: Cro/CI family transcriptional regulator
  • length: 67
  • theoretical pI: 9.43033
  • theoretical MW: 7688.8
  • GRAVY: -0.304478

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 33.5)
    and 7 more
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
    Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
    Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
    Signal transduction Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 20.3)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 18)
    Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 17.5)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.6)
  • TheSEED  :
    • Transcriptional regulator, Cro/CI family
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 54.7)
    and 20 more
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 43.3)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 34.3)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 30.3)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 21.7)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 21.1)
    HTH_11; HTH domain (PF08279; HMM-score: 18.6)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.1)
    Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 16.8)
    MarR; MarR family (PF01047; HMM-score: 16.7)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 16.6)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 15.9)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 15.9)
    LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 15.7)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 15.6)
    MarR_2; MarR family (PF12802; HMM-score: 14.8)
    TnsD; Tn7-like transposition protein D (PF15978; HMM-score: 14.2)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 14)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.7)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13)
    HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 11.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.983
    • Cytoplasmic Membrane Score: 0.0009
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0159
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002333
    • TAT(Tat/SPI): 0.001565
    • LIPO(Sec/SPII): 0.000634
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MRNRLKELRARDGLNQTQLAKQAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVFIIEEDEA

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: Cytoplasmic [1]
  • quantitative data / protein copy number per cell: 25 [2]
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  2. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]