From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00331
  • pan locus tag?: SAUPAN001892000
  • symbol: SAOUHSC_00331
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00331
  • symbol: SAOUHSC_00331
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 343418..343621
  • length: 204
  • essential: no [1] DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    GTGCGTAATCGATTGAAAGAATTACGAGCACGAGATGGCTTAAACCAAACGCAACTTGCT
    AAACAAGCGGGCGTTTCAAGACAAACCATATCGCTAATTGAGCGAAACAATTTTATGCCA
    TCAGTATTAACGGCAATAAAAATTGCTCGCATTTTCAATGAAACGGTGGAAACTGTTTTT
    ATTATTGAGGAGGATGAGGCATGA
    60
    120
    180
    204

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00331
  • symbol: SAOUHSC_00331
  • description: hypothetical protein
  • length: 67
  • theoretical pI: 9.43033
  • theoretical MW: 7688.8
  • GRAVY: -0.304478

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 33.5)
    and 7 more
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
    Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
    Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
    Signal transduction Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 20.3)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 18)
    Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 17.5)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.6)
  • TheSEED  :
    • Transcriptional regulator, Cro/CI family
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 56.5)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 46)
    and 19 more
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 35.4)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 26.4)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 22.6)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 22.6)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 19.7)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.9)
    MarR_2; MarR family (PF12802; HMM-score: 18.4)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.4)
    LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 18.3)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 18.2)
    MarR; MarR family (PF01047; HMM-score: 17)
    HTH_11; HTH domain (PF08279; HMM-score: 17)
    Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 15.9)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 14.1)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13.9)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.9)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 13.6)
    no clan defined TnsD; Tn7-like transposition protein D (PF15978; HMM-score: 13.4)
    HTH (CL0123) YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 12.8)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002333
    • TAT(Tat/SPI): 0.001565
    • LIPO(Sec/SPII): 0.000634
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MRNRLKELRARDGLNQTQLAKQAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVFIIEEDEA

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. ↑ 2.0 2.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_00331&oldid=102320"