PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 10-JUN-2013

⊟Summary

• organism: Staphylococcus aureus USA300_FPR3757
• locus tag: SAUSA300_0350 [new locus tag: SAUSA300_RS01855 ]
• pan locus tag^?: SAUPAN001892000
• symbol: SAUSA300_0350
• pan gene symbol^?: —
• synonym:
• product: Cro/CI family transcriptional regulator-like protein

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAUSA300_0350 [new locus tag: SAUSA300_RS01855 ]
• symbol: SAUSA300_0350
• product: Cro/CI family transcriptional regulator-like protein
• replicon: chromosome
• strand: +
• coordinates: 401561..401764
• length: 204
• essential: unknown other strains

⊟Accession numbers

• Gene ID: 3913137 NCBI
• RefSeq: YP_493064 NCBI
• BioCyc: see SAUSA300_RS01855
• MicrobesOnline: 1291865 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  181
  
  GTGCGTAATCGATTGAAAGAATTACGAGCACGAGATGGCTTAAACCAAACGCAACTTGCT
  AAACAAGCGGGCGTTTCAAGACAAACCATATCGCTAATTGAGCGAAACAATTTTATGCCA
  TCAGTATTAACGGCAATAAAAATTGCTCGCATTTTCAATGAAACGGTGGAAACTGTTTTT
  ATTATTGAGGAGGATGAGGCATGA
  60
  120
  180
  204
  

⊟Protein

⊟General

• locus tag: SAUSA300_0350 [new locus tag: SAUSA300_RS01855 ]
• symbol: SAUSA300_0350
• description: Cro/CI family transcriptional regulator-like protein
• length: 67
• theoretical pI: 9.43033
• theoretical MW: 7688.8
• GRAVY: -0.304478

⊟Function

• TIGRFAM:
  Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 33.5)
  and 7 more
  Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
  Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
  Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)
  Signal transduction Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 20.3)
  putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 18)
  Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 17.5)
  RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.6)
• TheSEED  :
  • Transcriptional regulator, Cro/CI family
• PFAM:
  HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 56.5)
  HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 46)
  and 19 more
  HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 35.4)
  HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 26.4)
  HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 22.6)
  Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 22.6)
  HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 19.7)
  HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.9)
  MarR_2; MarR family (PF12802; HMM-score: 18.4)
  HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.4)
  LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 18.3)
  HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 18.2)
  MarR; MarR family (PF01047; HMM-score: 17)
  HTH_11; HTH domain (PF08279; HMM-score: 17)
  Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 15.9)
  HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 14.1)
  HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 13.9)
  HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.9)
  HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 13.6)
  no clan defined TnsD; Tn7-like transposition protein D (PF15978; HMM-score: 13.4)
  HTH (CL0123) YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 12.8)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic
  • Cytoplasmic Score: 7.5
  • Cytoplasmic Membrane Score: 1.15
  • Cellwall Score: 0.62
  • Extracellular Score: 0.73
  • Internal Helices: 0
• LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 1
  • Signal peptide possibility: -1
  • N-terminally Anchored Score: 1
  • Predicted Cleavage Site: No CleavageSite
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.002333
  • TAT(Tat/SPI): 0.001565
  • LIPO(Sec/SPII): 0.000634
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 87160419 NCBI
• RefSeq: YP_493064 NCBI
• UniProt: A0A0H2XGL7 UniProt

⊟Protein sequence

• MRNRLKELRARDGLNQTQLAKQAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVFIIEEDEA

⊟Experimental data

• experimentally validated:
• protein localization: data available for COL
• quantitative data / protein copy number per cell: data available for COL
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SAUSA300_0350 > SAUSA300_0351 > SAUSA300_0352 > SAUSA300_0353

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications