Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0337 [new locus tag: SA_RS01930 ]
- pan locus tag?: SAUPAN001892000
- symbol: SA0337
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0337 [new locus tag: SA_RS01930 ]
- symbol: SA0337
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 394648..394851
- length: 204
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123116 NCBI
- RefSeq: NP_373583 NCBI
- BioCyc: see SA_RS01930
- MicrobesOnline: 102609 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGCGTAATCGATTGAAAGAGTTACGAGCACGAGATGGCTTAAATCAAACGCAGCTTGCC
AAACTAGCTGGTGTTTCAAGACAAACCATTTCGCTAATTGAGCGAAACAATTTTATGCCA
TCAGTATTAACGGCAATAAAGATTGCTCGCATTTTCAATGAAACGGTGGAAACGGTTTTT
ATTATTGAGGAGGATGAAGCATGA60
120
180
204
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0337 [new locus tag: SA_RS01930 ]
- symbol: SA0337
- description: hypothetical protein
- length: 67
- theoretical pI: 9.43033
- theoretical MW: 7673.83
- GRAVY: -0.195522
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 34.9)and 7 moreRegulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 20.5)putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 20.5)Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 20.3)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 20.3)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 20.3)Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 15.8)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.5)
- TheSEED :
- Transcriptional regulator SERP0029, Xre family
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 55.1)and 21 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 41.2)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 34.4)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 29.4)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 20.2)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 19.7)Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 17.1)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 17)LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 16.3)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 16.3)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 16.2)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 16.1)HTH_11; HTH domain (PF08279; HMM-score: 16)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 15.8)MarR; MarR family (PF01047; HMM-score: 15.4)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 15.1)Xre-like-HTH; Antitoxin Xre-like helix-turn-helix domain (PF20432; HMM-score: 15.1)MarR_2; MarR family (PF12802; HMM-score: 15)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.9)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13)TnsD; Tn7-like transposition protein D (PF15978; HMM-score: 12.7)MerR; MerR family regulatory protein (PF00376; HMM-score: 11.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9691
- Cytoplasmic Membrane Score: 0.0017
- Cell wall & surface Score: 0.0003
- Extracellular Score: 0.029
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002957
- TAT(Tat/SPI): 0.001962
- LIPO(Sec/SPII): 0.00087
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRNRLKELRARDGLNQTQLAKLAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVFIIEEDEA
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SA0337 > SA0338 > SA0339 > SA0340
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]