From AureoWiki
Jump to navigation Jump to search

NCBI: 26-AUG-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus N315
  • locus tag: SA0337 [new locus tag: SA_RS01930 ]
  • pan locus tag?: SAUPAN001892000
  • symbol: SA0337
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SA0337 [new locus tag: SA_RS01930 ]
  • symbol: SA0337
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 394648..394851
  • length: 204
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    GTGCGTAATCGATTGAAAGAGTTACGAGCACGAGATGGCTTAAATCAAACGCAGCTTGCC
    AAACTAGCTGGTGTTTCAAGACAAACCATTTCGCTAATTGAGCGAAACAATTTTATGCCA
    TCAGTATTAACGGCAATAAAGATTGCTCGCATTTTCAATGAAACGGTGGAAACGGTTTTT
    ATTATTGAGGAGGATGAAGCATGA
    60
    120
    180
    204


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SA0337 [new locus tag: SA_RS01930 ]
  • symbol: SA0337
  • description: hypothetical protein
  • length: 67
  • theoretical pI: 9.43033
  • theoretical MW: 7673.83
  • GRAVY: -0.195522

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 34.9)
    and 7 more
    Signal transduction Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 20.5)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 20.5)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 20.3)
    Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 20.3)
    Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 20.3)
    Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 15.8)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 13.5)
  • TheSEED  :
    • Transcriptional regulator SERP0029, Xre family
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 55.1)
    and 21 more
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 41.2)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 34.4)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 29.4)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 20.2)
    HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 19.7)
    Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 17.1)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 17)
    LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 16.3)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 16.3)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 16.2)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 16.1)
    HTH_11; HTH domain (PF08279; HMM-score: 16)
    HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 15.8)
    MarR; MarR family (PF01047; HMM-score: 15.4)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 15.1)
    Xre-like-HTH; Antitoxin Xre-like helix-turn-helix domain (PF20432; HMM-score: 15.1)
    MarR_2; MarR family (PF12802; HMM-score: 15)
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.9)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13)
    TnsD; Tn7-like transposition protein D (PF15978; HMM-score: 12.7)
    MerR; MerR family regulatory protein (PF00376; HMM-score: 11.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9691
    • Cytoplasmic Membrane Score: 0.0017
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.029
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002957
    • TAT(Tat/SPI): 0.001962
    • LIPO(Sec/SPII): 0.00087
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MRNRLKELRARDGLNQTQLAKLAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVFIIEEDEA

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]