Jump to navigation
Jump to search
NCBI: 01-DEC-2025
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus JSNZ
- locus tag: EGJ38_000303 [new locus tag: EGJ38_RS01515 ]
- pan locus tag?: SAUPAN001892000
- symbol: EGJ38_000303
- pan gene symbol?: —
- synonym:
- alternate name: JSNZ_000303
- product: helix-turn-helix transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: EGJ38_000303 [new locus tag: EGJ38_RS01515 ]
- symbol: EGJ38_000303
- product: helix-turn-helix transcriptional regulator
- replicon: chromosome
- strand: +
- coordinates: 339490..339693
- length: 204
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID:
- RefSeq: MGT2422306 NCBI
- BioCyc:
- MicrobesOnline:
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181GTGCGTAATCGATTGAAAGAATTACGAGCACGAGATGGCTTAAACCAAACGCAACTTGCT
AAACAAGCGGGCGTTTCAAGACAAACCATATCGCTAATTGAGCGAAACAATTTTATGCCA
TCAGTATTAACGGCAATAAAAATTGCTCGGATTTTCAATGAAACGGTGGAAACTGTTTTT
ATTATTGAGGAGGATGAGGTATGA60
120
180
204
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: EGJ38_000303 [new locus tag: EGJ38_RS01515 ]
- symbol: EGJ38_000303
- description: helix-turn-helix transcriptional regulator
- length: 67
- theoretical pI: 9.43033
- theoretical MW: 7716.85
- GRAVY: -0.268657
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 33.5)and 7 moreMobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 22.7)Regulatory functions DNA interactions DNA-binding protein, Tfx family (TIGR00721; HMM-score: 20.1)putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 18)Unknown function General mobile mystery protein A (TIGR02612; HMM-score: 17.6)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14.6)
- TheSEED: data available for COL, N315, NCTC8325, USA300_FPR3757
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 54.7)and 20 moreHTH_19; Helix-turn-helix domain (PF12844; HMM-score: 43.3)HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 34.3)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 30.3)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 21.7)HTH_7; Helix-turn-helix domain of resolvase (PF02796; HMM-score: 21.1)HTH_11; HTH domain (PF08279; HMM-score: 18.6)HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 18.1)Phage_CI_repr; Bacteriophage CI repressor helix-turn-helix domain (PF07022; HMM-score: 16.8)MarR; MarR family (PF01047; HMM-score: 16.6)HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 16.6)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 15.9)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 15.9)LacI; Bacterial regulatory proteins, lacI family (PF00356; HMM-score: 15.7)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 15.6)MarR_2; MarR family (PF12802; HMM-score: 14.8)TnsD; Tn7-like transposition protein D (PF15978; HMM-score: 14.2)HTH_38; Helix-turn-helix domain (PF13936; HMM-score: 14)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.7)HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13)HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 11.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9834
- Cytoplasmic Membrane Score: 0.0009
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0155
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002289
- TAT(Tat/SPI): 0.001757
- LIPO(Sec/SPII): 0.000657
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI:
- RefSeq: MGT2422306 NCBI
- UniProt:
⊟Protein sequence[edit | edit source]
- MRNRLKELRARDGLNQTQLAKQAGVSRQTISLIERNNFMPSVLTAIKIARIFNETVETVFIIEEDEV
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- Operon-mapper [1] : EGJ38_000303 > EGJ38_000304 > EGJ38_000305 > EGJ38_000306
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Blanca Taboada, Karel Estrada, Ricardo Ciria, Enrique Merino
Operon-mapper: a web server for precise operon identification in bacterial and archaeal genomes.
Bioinformatics: 2018, 34(23);4118-4120
[PubMed:29931111] [WorldCat.org] [DOI] (I p)