From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0880 [new locus tag: SACOL_RS04520 ]
  • pan locus tag?: SAUPAN002835000
  • symbol: SACOL0880
  • pan gene symbol?:
  • synonym:
  • product: TOPRIM domain-containing protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0880 [new locus tag: SACOL_RS04520 ]
  • symbol: SACOL0880
  • product: TOPRIM domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 899871..900257
  • length: 387
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGCTATTGTAAATAAAGTGATAATTGTTGAAGGAAAATCTGATAAAAAAAGGGTGCAA
    CAGGTTATTGCAGAACCAGTCAATATTATTTGTACTCATGGAACAATGAGTATAGATAAG
    CTTGATGATATGATAGAATCACTGTATGATAAACAAGTTTTTGTATTAGCCGATTCTGAT
    GACGAAGGAGATCGAATTAGAAATTGGTTTAAACGTTATTTGAGTGAAAGTGAACATATA
    TTTATTGATAAAACTTACTGTCAAGTTGCGAATTGCCCCAAACAATATTTGGCGCATGTA
    CTTTCAAAACATGGCTTTACTTGTAAGAAAGAAACACCTCTTTTACCGAATATAAATAAT
    GAAAGGTTAGTTTTAGTAAATGAATAA
    60
    120
    180
    240
    300
    360
    387


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0880 [new locus tag: SACOL_RS04520 ]
  • symbol: SACOL0880
  • description: TOPRIM domain-containing protein
  • length: 128
  • theoretical pI: 6.505
  • theoretical MW: 14751.9
  • GRAVY: -0.304688

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Transcription RNA processing ribonuclease M5 (TIGR00334; EC 3.1.26.8; HMM-score: 51.5)
    and 1 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA gyrase, B subunit (TIGR01059; EC 5.99.1.3; HMM-score: 14.6)
  • TheSEED  :
    • Toprim domain protein
  • PFAM:
    Toprim-like (CL0413) Toprim; Toprim domain (PF01751; HMM-score: 34.1)
    and 5 more
    OLD-like_TOPRIM; Overcoming lysogenization defect protein-like, TOPRIM domain (PF20469; HMM-score: 17.8)
    Toprim_2; Toprim-like (PF13155; HMM-score: 16.3)
    no clan defined DUF2100; Uncharacterized protein conserved in archaea (DUF2100) (PF09873; HMM-score: 15.2)
    Toprim-like (CL0413) Toprim_4; Toprim domain (PF13662; HMM-score: 14.6)
    no clan defined Calc_CGRP_IAPP; Calcitonin / CGRP / IAPP family (PF00214; HMM-score: 13.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9775
    • Cytoplasmic Membrane Score: 0.0064
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0159
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004075
    • TAT(Tat/SPI): 0.000121
    • LIPO(Sec/SPII): 0.000642
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLADSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGFTCKKETPLLPNINNERLVLVNE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [1]   other strains

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]