From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00840
  • pan locus tag?: SAUPAN002835000
  • symbol: SAOUHSC_00840
  • pan gene symbol?:
  • synonym: JSNZ_000794
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00840
  • symbol: SAOUHSC_00840
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 812195..812581
  • length: 387
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGGCTATTGTAAATAAAGTGATAATTGTTGAAGGAAAATCTGATAAAAAAAGGGTGCAA
    CAGGTTATTGCAGAACCAGTCAATATTATTTGTACTCATGGAACAATGAGTATAGATAAG
    CTTGATGATATGATAGAATCACTGTATGATAAACAAGTTTTTGTATTAGCCGATTCTGAT
    GACGAAGGAGATCGAATTAGAAATTGGTTTAAACGTTATTTGAGTGAAAGTGAACATATA
    TTTATTGATAAAACTTACTGTCAAGTTGCGAATTGCCCCAAACAATATTTGGCGCATGTA
    CTTTCAAAACATGGCTTTACTTGTAAGAAAGAAACACCTCTTTTACCGAATATAAATAAT
    GAAAGGTTAGTTTTAGTAAATGAATAA
    60
    120
    180
    240
    300
    360
    387

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00840
  • symbol: SAOUHSC_00840
  • description: hypothetical protein
  • length: 128
  • theoretical pI: 6.505
  • theoretical MW: 14751.9
  • GRAVY: -0.304688

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Transcription RNA processing ribonuclease M5 (TIGR00334; EC 3.1.26.8; HMM-score: 51.5)
    and 1 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DNA gyrase, B subunit (TIGR01059; EC 5.99.1.3; HMM-score: 14.6)
  • TheSEED  :
    • Toprim domain protein
  • PFAM:
    Toprim-like (CL0413) Toprim; Toprim domain (PF01751; HMM-score: 34.1)
    and 5 more
    OLD-like_TOPRIM; Overcoming lysogenization defect protein-like, TOPRIM domain (PF20469; HMM-score: 17.8)
    Toprim_2; Toprim-like (PF13155; HMM-score: 16.3)
    no clan defined DUF2100; Uncharacterized protein conserved in archaea (DUF2100) (PF09873; HMM-score: 15.2)
    Toprim-like (CL0413) Toprim_4; Toprim domain (PF13662; HMM-score: 14.6)
    no clan defined Calc_CGRP_IAPP; Calcitonin / CGRP / IAPP family (PF00214; HMM-score: 13.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9775
    • Cytoplasmic Membrane Score: 0.0064
    • Cell wall & surface Score: 0.0002
    • Extracellular Score: 0.0159
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004075
    • TAT(Tat/SPI): 0.000121
    • LIPO(Sec/SPII): 0.000642
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAIVNKVIIVEGKSDKKRVQQVIAEPVNIICTHGTMSIDKLDDMIESLYDKQVFVLADSDDEGDRIRNWFKRYLSESEHIFIDKTYCQVANCPKQYLAHVLSKHGFTCKKETPLLPNINNERLVLVNE

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB*/JSNZ_002025 (activation) regulon
    SigB*/JSNZ_002025(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [2] [1]   other strains

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. 1.0 1.1 1.2 1.3 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)
  2. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]