Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0985 [new locus tag: SACOL_RS05040 ]
- pan locus tag?: SAUPAN003124000
- symbol: SACOL0985
- pan gene symbol?: —
- synonym:
- product: surface protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0985 [new locus tag: SACOL_RS05040 ]
- symbol: SACOL0985
- product: surface protein
- replicon: chromosome
- strand: +
- coordinates: 993585..994019
- length: 435
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237907 NCBI
- RefSeq: YP_185853 NCBI
- BioCyc: see SACOL_RS05040
- MicrobesOnline: 912454 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAATTAAAATCATTTATAACTGTAACTTTGGCACTGGGCATGATCGCAACGACTGGC
GCTACTGTGGCAGGTAATGAGGTATCTGCAGCAGAAAAGGACAAACTACCGGCAACTCAA
AAAGCTAAAGAAATGCAAAATGTTCCATATACAATTGCAGTAGATGGCATTATGGCTTTC
AATCAATCTTACTTAAATTTACCAAAAGATAGCCAATTATCATATTTAGATTTAGGAAAT
AAAGTTAAAGCTTTGTTATATGATGAACGCGGTGTAACACCTGAGAAGATTCGAAATGCA
AAATCTGCCGTTTACACGATTACTTGGAAAGATGGTAGTAAAAAAGAAGTGGATCTTAAG
AAAGATAGCTACACAGCAAACTTGTTTGATTCAAATTCAATTAAACAAATTGATATTAAT
GTAAAAACTAAATAA60
120
180
240
300
360
420
435
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0985 [new locus tag: SACOL_RS05040 ]
- symbol: SACOL0985
- description: surface protein
- length: 144
- theoretical pI: 9.84615
- theoretical MW: 15838.1
- GRAVY: -0.342361
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- Similar to cell surface protein Map-w
- PFAM: no clan defined MAP; MAP domain (PF03642; HMM-score: 126.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 9.68
- Cellwall Score: 0.17
- Extracellular Score: 0.16
- Internal Helix: 1
- DeepLocPro: Extracellular
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.0011
- Cell wall & surface Score: 0.0227
- Extracellular Score: 0.9762
- LocateP: N-terminally anchored (with CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: -0.17
- Signal peptide possibility: 1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: NEVSAAEK
- SignalP: Signal peptide SP(Sec/SPI) length 30 aa
- SP(Sec/SPI): 0.973909
- TAT(Tat/SPI): 0.003194
- LIPO(Sec/SPII): 0.020514
- Cleavage Site: CS pos: 30-31. VSA-AE. Pr: 0.7117
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKLKSFITVTLALGMIATTGATVAGNEVSAAEKDKLPATQKAKEMQNVPYTIAVDGIMAFNQSYLNLPKDSQLSYLDLGNKVKALLYDERGVTPEKIRNAKSAVYTITWKDGSKKEVDLKKDSYTANLFDSNSIKQIDINVKTK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Signal peptide containing [1] [2] [3] [4] [5]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Annette Dreisbach, Kristina Hempel, Girbe Buist, Michael Hecker, Dörte Becher, Jan Maarten van Dijl
Profiling the surfacome of Staphylococcus aureus.
Proteomics: 2010, 10(17);3082-96
[PubMed:20662103] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)