Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1101 [new locus tag: SACOL_RS05625 ]
- pan locus tag?: SAUPAN003316000
- symbol: SACOL1101
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1101 [new locus tag: SACOL_RS05625 ]
- symbol: SACOL1101
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1111273..1111899
- length: 627
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237844 NCBI
- RefSeq: YP_185965 NCBI
- BioCyc: see SACOL_RS05625
- MicrobesOnline: 912569 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAAATTTGGAAAAACAATCGCAGTAGTATTAGCATCTAGTGTCTTGCTTGCAGGATGT
ACTACGGATAAAAAAGAAATTAAGGCATATTTAAAGCAAGTGGATAAAATTAAAGATGAT
GAAGAACCAATTAAAACTGTTGGTAAGAAAATTGCTGAATTAGATGAGAAAAAGAAAAAA
TTAACTGAAGATGTCAATAGTAAAGATACAGCAGTTCGCGGTAAAGCAGTAAAGGATTTA
ATTAAAAATGCCGATGATCGTCTAAAGGAATTTGAAAAAGAAGAAGACGCAATTAAGAAG
TCTGAACAAGACTTTAAGAAAGCAAAAAGTCACGTTGATAACATTGATAATGATGTTAAA
CGTAAAGAAGTAAAACAATTAGATGATGTATTAAAAGAAAAATATAAGTTACACAGTGAT
TACGCGAAAGCATATAAAAAGGCTGTAAACTCAGAGAAAACATTATTTAAATATTTAAAT
CAAAATGACGCGACACAACAAGGTGTTAACGAAAAATCAAAAGCAATAGAACAGAACTAT
AAAAAGTTAAAAGAAGTATCAGATAAGTATACAAAAGTACTAAATAAGGTTGGTAAAGAA
AAGCAAGACGTTGATCAATTTAAATAA60
120
180
240
300
360
420
480
540
600
627
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1101 [new locus tag: SACOL_RS05625 ]
- symbol: SACOL1101
- description: hypothetical protein
- length: 208
- theoretical pI: 9.96393
- theoretical MW: 23875.2
- GRAVY: -1.06587
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 15.4)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 15.4)type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 12.8)and 6 moreCellular processes Biosynthesis of natural products NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 9)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 9)SH3 domain protein (TIGR04211; HMM-score: 8.1)two transmembrane protein (TIGR04527; HMM-score: 7.7)Mobile and extrachromosomal element functions Plasmid functions conjugative transfer region lipoprotein, TIGR03751 family (TIGR03751; HMM-score: 5.9)phage lysis regulatory protein, LysB family (TIGR03495; HMM-score: 5.2)
- TheSEED :
- FIG01108153: hypothetical protein
- PFAM: no clan defined YkyA; Putative cell-wall binding lipoprotein (PF10368; HMM-score: 116.6)and 19 moreMce4_CUP1; Cholesterol uptake porter CUP1 of Mce4, putative (PF11887; HMM-score: 22)TPR (CL0020) COG6_N; Conserved oligomeric complex COG6, N-terminal (PF06419; HMM-score: 16.7)no clan defined Med4; Vitamin-D-receptor interacting Mediator subunit 4 (PF10018; HMM-score: 14.1)APG6_N; Apg6 coiled-coil region (PF17675; HMM-score: 13.7)DUF948; Bacterial protein of unknown function (DUF948) (PF06103; HMM-score: 12.4)BORCS7; BLOC-1-related complex sub-unit 7 (PF16088; HMM-score: 12.1)DmpA_ArgJ (CL0635) MoCoBD_2; Molybdopterin cofactor-binding domain (PF20256; HMM-score: 12)TerB (CL0414) TerB; Tellurite resistance protein TerB (PF05099; HMM-score: 11.2)no clan defined BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 11.1)DASH_Duo1; DASH complex subunit Duo1 (PF08651; HMM-score: 10.6)IL31; Interleukin 31 (PF15209; HMM-score: 10.4)ABC_tran_CTD; ABC transporter C-terminal domain (PF16326; HMM-score: 9.9)Golgi-transport (CL0145) BAR_3; BAR domain of APPL family (PF16746; HMM-score: 8.7)MazG (CL0231) Nuf2_DHR10-like; Nuf2, DHR10-like domain (PF18595; HMM-score: 8.4)no clan defined Spc7; Spc7 kinetochore protein (PF08317; HMM-score: 7.6)P-loop_NTPase (CL0023) AAA_13; AAA domain (PF13166; HMM-score: 7.2)no clan defined UPF0242; Uncharacterised protein family (UPF0242) N-terminus (PF06785; HMM-score: 7.1)Cyclin (CL0065) DUF3452; Domain of unknown function (DUF3452) (PF11934; HMM-score: 6.8)no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 5.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.8972
- Cell wall & surface Score: 0.0592
- Extracellular Score: 0.0435
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: 0
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: VLLAGCT
- SignalP: Signal peptide LIPO(Sec/SPII) length 19 aa
- SP(Sec/SPI): 0.000447
- TAT(Tat/SPI): 0.000065
- LIPO(Sec/SPII): 0.999242
- Cleavage Site: CS pos: 19-20. LAG-CT. Pr: 0.9999
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKFGKTIAVVLASSVLLAGCTTDKKEIKAYLKQVDKIKDDEEPIKTVGKKIAELDEKKKKLTEDVNSKDTAVRGKAVKDLIKNADDRLKEFEKEEDAIKKSEQDFKKAKSHVDNIDNDVKRKEVKQLDDVLKEKYKLHSDYAKAYKKAVNSEKTLFKYLNQNDATQQGVNEKSKAIEQNYKKLKEVSDKYTKVLNKVGKEKQDVDQFK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Lipoprotein [1] [2] [3] [4]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 5.79 h [5]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)