Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_01039
- pan locus tag?: SAUPAN003316000
- symbol: SAOUHSC_01039
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_01039
- symbol: SAOUHSC_01039
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1007610..1008236
- length: 627
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3919887 NCBI
- RefSeq: YP_499588 NCBI
- BioCyc: G1I0R-978 BioCyc
- MicrobesOnline: 1289501 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAAATTTGGAAAAACAATCGCAGTAGTATTAGCATCTAGTGTCTTGCTTGCAGGATGT
ACTACGGATAAAAAAGAAATTAAGGCATATTTAAAGCAAGTGGATAAAATTAAAGATGAT
GAAGAACCAATTAAAACTGTTGGTAAGAAAATTGCTGAATTAGATGAGAAAAAGAAAAAA
TTAACTGAAGATGTCAATAGTAAAGATACAGCAGTTCGCGGTAAAGCAGTAAAGGATTTA
ATTAAAAATGCCGATGATCGTCTAAAGGAATTTGAAAAAGAAGAAGACGCAATTAAGAAG
TCTGAACAAGACTTTAAGAAAGCAAAAAGTCACGTTGATAACATTGATAATGATGTTAAA
CGTAAAGAAGTAAAACAATTAGATGATGTATTAAAAGAAAAATATAAGTTACACAGTGAT
TACGCGAAAGCATATAAAAAGGCTGTAAACTCAGAGAAAACATTATTTAAATATTTAAAT
CAAAATGACGCGACACAACAAGGTGTTAACGAAAAATCAAAAGCAATAGAACAGAACTAT
AAAAAGTTAAAAGAAGTATCAGATAAGTATACAAAAGTACTAAATAAGGTTGGTAAAGAA
AAGCAAGACGTTGATCAATTTAAATAA60
120
180
240
300
360
420
480
540
600
627
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_01039
- symbol: SAOUHSC_01039
- description: hypothetical protein
- length: 208
- theoretical pI: 9.96393
- theoretical MW: 23875.2
- GRAVY: -1.06587
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 15.4)DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 15.4)type VII secretion effector, TIGR04197 family (TIGR04197; HMM-score: 12.8)and 6 moreCellular processes Biosynthesis of natural products NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 9)Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 9)SH3 domain protein (TIGR04211; HMM-score: 8.1)two transmembrane protein (TIGR04527; HMM-score: 7.7)Mobile and extrachromosomal element functions Plasmid functions conjugative transfer region lipoprotein, TIGR03751 family (TIGR03751; HMM-score: 5.9)phage lysis regulatory protein, LysB family (TIGR03495; HMM-score: 5.2)
- TheSEED :
- FIG01108153: hypothetical protein
- PFAM: no clan defined YkyA; Putative cell-wall binding lipoprotein (PF10368; HMM-score: 116.6)and 19 moreMce4_CUP1; Cholesterol uptake porter CUP1 of Mce4, putative (PF11887; HMM-score: 22)TPR (CL0020) COG6_N; Conserved oligomeric complex COG6, N-terminal (PF06419; HMM-score: 16.7)no clan defined Med4; Vitamin-D-receptor interacting Mediator subunit 4 (PF10018; HMM-score: 14.1)APG6_N; Apg6 coiled-coil region (PF17675; HMM-score: 13.7)DUF948; Bacterial protein of unknown function (DUF948) (PF06103; HMM-score: 12.4)BORCS7; BLOC-1-related complex sub-unit 7 (PF16088; HMM-score: 12.1)DmpA_ArgJ (CL0635) MoCoBD_2; Molybdopterin cofactor-binding domain (PF20256; HMM-score: 12)TerB (CL0414) TerB; Tellurite resistance protein TerB (PF05099; HMM-score: 11.2)no clan defined BLOC1_2; Biogenesis of lysosome-related organelles complex-1 subunit 2 (PF10046; HMM-score: 11.1)DASH_Duo1; DASH complex subunit Duo1 (PF08651; HMM-score: 10.6)IL31; Interleukin 31 (PF15209; HMM-score: 10.4)ABC_tran_CTD; ABC transporter C-terminal domain (PF16326; HMM-score: 9.9)Golgi-transport (CL0145) BAR_3; BAR domain of APPL family (PF16746; HMM-score: 8.7)MazG (CL0231) Nuf2_DHR10-like; Nuf2, DHR10-like domain (PF18595; HMM-score: 8.4)no clan defined Spc7; Spc7 kinetochore protein (PF08317; HMM-score: 7.6)P-loop_NTPase (CL0023) AAA_13; AAA domain (PF13166; HMM-score: 7.2)no clan defined UPF0242; Uncharacterised protein family (UPF0242) N-terminus (PF06785; HMM-score: 7.1)Cyclin (CL0065) DUF3452; Domain of unknown function (DUF3452) (PF11934; HMM-score: 6.8)no clan defined V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 5.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 3.33
- Cellwall Score: 3.33
- Extracellular Score: 3.33
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.8972
- Cell wall & surface Score: 0.0592
- Extracellular Score: 0.0435
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: 0
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: VLLAGCT
- SignalP: Signal peptide LIPO(Sec/SPII) length 19 aa
- SP(Sec/SPI): 0.000447
- TAT(Tat/SPI): 0.000065
- LIPO(Sec/SPII): 0.999242
- Cleavage Site: CS pos: 19-20. LAG-CT. Pr: 0.9999
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKFGKTIAVVLASSVLLAGCTTDKKEIKAYLKQVDKIKDDEEPIKTVGKKIAELDEKKKKLTEDVNSKDTAVRGKAVKDLIKNADDRLKEFEKEEDAIKKSEQDFKKAKSHVDNIDNDVKRKEVKQLDDVLKEKYKLHSDYAKAYKKAVNSEKTLFKYLNQNDATQQGVNEKSKAIEQNYKKLKEVSDKYTKVLNKVGKEKQDVDQFK
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [1] [2]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- predicted SigA promoter [3] : S424 > SAOUHSC_01039 > S425
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [3]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e) - ↑ 3.0 3.1 3.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e)
