From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1107 [new locus tag: SACOL_RS05655 ]
  • pan locus tag?: SAUPAN003322000
  • symbol: SACOL1107
  • pan gene symbol?: —
  • synonym:
  • product: Cro/CI family transcriptional regulator

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1107 [new locus tag: SACOL_RS05655 ]
  • symbol: SACOL1107
  • product: Cro/CI family transcriptional regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 1117543..1118082
  • length: 540
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAACATAGGTAATAAAATTAAAAATCTTAGAAGAATTAAAAATTTAACGCAAGAAGAA
    CTTGCTGAACGTACAGACTTATCGAAAGGCTACATTTCACAAATAGAAAGTGAACATGCC
    TCACCAAGTATGGAAACTTTCTTAAATATTATAGAGGTGTTAGGAACGACGCCAAGTGAA
    TTTTTTAAAGACAGTGAAAATGAAAAAGTATTATACAAGAAGGAAGAACAAGTTATTTAT
    GATGAGTATGATGAAGGTTATATATTAAATTGGTTAGTTTCAAAGTCAAATGAATATGAT
    ATGGAGCCATTAATATTAACTTTAAAGCCTGGAGCATCATATAAAAATTTTAATCCATCA
    GAGTCTGATACGTTTATTTATTGTATGTCAGGTCAGATAACACTTAATTTAGGCAAAGAG
    ATATATCAAGCACAAGAAGAAGACGTTTTGTATTTTAAAGCACGAGATAATCATCGTTTG
    TCAAACGAATCAAACAATGAAACACGAATACTTATTGTAGCGACAGCTTCATATTTATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1107 [new locus tag: SACOL_RS05655 ]
  • symbol: SACOL1107
  • description: Cro/CI family transcriptional regulator
  • length: 179
  • theoretical pI: 4.42625
  • theoretical MW: 20745.1
  • GRAVY: -0.602235

⊟Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 41.7)
    putative allantoin catabolism protein (TIGR03214; HMM-score: 36.2)
    and 6 more
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 19)
    Genetic information processing Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)
    Signal transduction Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)
    Signal transduction Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 15.8)
    Hypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 13.8)
  • TheSEED  :
    • Transcriptional regulator PotR
    Amino Acids and Derivatives Arginine; urea cycle, polyamines Polyamine Metabolism  Transcriptional regulator, MerR family, near polyamine transporter
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 54.3)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 46.4)
    and 13 more
    Cupin (CL0029) Cupin_2; Cupin domain (PF07883; HMM-score: 38.8)
    HTH (CL0123) HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 35.1)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 24.8)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 22.9)
    Cupin (CL0029) Pirin_C; Pirin C-terminal cupin domain (PF05726; HMM-score: 21.8)
    AraC_binding; AraC-like ligand binding domain (PF02311; HMM-score: 20.2)
    HTH (CL0123) HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 18.9)
    no clan defined DUF896; Bacterial protein of unknown function (DUF896) (PF05979; HMM-score: 17.8)
    Cupin (CL0029) CENP-C_C; Mif2/CENP-C like (PF11699; HMM-score: 16.8)
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 16.3)
    Cupin (CL0029) MannoseP_isomer; Mannose-6-phosphate isomerase (PF01050; HMM-score: 14.7)
    HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13.2)
    HTH_37; Helix-turn-helix domain (PF13744; HMM-score: 13)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003694
    • TAT(Tat/SPI): 0.000577
    • LIPO(Sec/SPII): 0.000429
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNIGNKIKNLRRIKNLTQEELAERTDLSKGYISQIESEHASPSMETFLNIIEVLGTTPSEFFKDSENEKVLYKKEEQVIYDEYDEGYILNWLVSKSNEYDMEPLILTLKPGASYKNFNPSESDTFIYCMSGQITLNLGKEIYQAQEEDVLYFKARDNHRLSNESNNETRILIVATASYL

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell: 135 [3]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL1107&oldid=69656"