Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0949 [new locus tag: SA_RS05375 ]
- pan locus tag?: SAUPAN003322000
- symbol: SA0949
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0949 [new locus tag: SA_RS05375 ]
- symbol: SA0949
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 1076315..1076854
- length: 540
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123773 NCBI
- RefSeq: NP_374216 NCBI
- BioCyc: see SA_RS05375
- MicrobesOnline: 103242 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481ATGAACATAGGTAATAAAATTAAAAATCTTAGAAGAATTAAAAATTTAACGCAAGAAGAA
CTTGCTGAACGTACAGACTTATCGAAAGGCTACATTTCACAAATAGAAAGTGAACATGCC
TCACCAAGTATGGAAACTTTCTTAAATATTATAGAGGTGTTAGGAACGACGCCAAGTGAA
TTTTTTAAAGACAGTGAAAATGAAAAAGTATTATACAAGAAGGAAGAACAAGTTATTTAT
GATGAGTATGATGAAGGTTATATATTAAATTGGTTAGTTTCAAAGTCAAATGAATATGAT
ATGGAGCCATTAATATTAACTTTAAAGCCTGGAGCATCATATAAAAATTTTAATCCATCA
GAGTCTGATACGTTTATTTATTGTATGTCAGGTCAGATAACACTTAATTTAGGCAAAGAG
ATATATCAAGCACAAGAAGAAGACGTTTTGTATTTTAAAGCACGAGATAATCATCGTTTG
TCAAACGAATCAAACAATGAAACACGAATACTTATTGTAGCGACAGCTTCATATTTATAG60
120
180
240
300
360
420
480
540
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0949 [new locus tag: SA_RS05375 ]
- symbol: SA0949
- description: hypothetical protein
- length: 179
- theoretical pI: 4.42625
- theoretical MW: 20745.1
- GRAVY: -0.602235
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions transcriptional regulator, y4mF family (TIGR03070; HMM-score: 41.7)putative allantoin catabolism protein (TIGR03214; HMM-score: 36.2)and 6 moreputative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 19)Mobile and extrachromosomal element functions Other addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)Regulatory functions DNA interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)Regulatory functions Protein interactions addiction module antidote protein, HigA family (TIGR02607; HMM-score: 16.6)RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 15.8)Hypothetical proteins Conserved TIGR00270 family protein (TIGR00270; HMM-score: 13.8)
- TheSEED :
- Transcriptional regulator PotR
- PFAM: HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 55.5)HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 46.7)and 12 moreCupin (CL0029) Cupin_2; Cupin domain (PF07883; HMM-score: 40)HTH (CL0123) HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 36.4)HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 25.7)Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 25.3)Cupin (CL0029) Pirin_C; Pirin C-terminal cupin domain (PF05726; HMM-score: 22.6)AraC_binding; AraC-like ligand binding domain (PF02311; HMM-score: 21)HTH (CL0123) HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 19.4)no clan defined DUF896; Bacterial protein of unknown function (DUF896) (PF05979; HMM-score: 17)HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 14.5)Cupin (CL0029) CENP-C_C; Mif2/CENP-C like (PF11699; HMM-score: 14.3)HTH (CL0123) HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 13.4)Cupin (CL0029) MannoseP_isomer; Mannose-6-phosphate isomerase C-terminal (PF01050; HMM-score: 13)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9281
- Cytoplasmic Membrane Score: 0.0116
- Cell wall & surface Score: 0.0002
- Extracellular Score: 0.0601
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003694
- TAT(Tat/SPI): 0.000577
- LIPO(Sec/SPII): 0.000429
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNIGNKIKNLRRIKNLTQEELAERTDLSKGYISQIESEHASPSMETFLNIIEVLGTTPSEFFKDSENEKVLYKKEEQVIYDEYDEGYILNWLVSKSNEYDMEPLILTLKPGASYKNFNPSESDTFIYCMSGQITLNLGKEIYQAQEEDVLYFKARDNHRLSNESNNETRILIVATASYL
⊟Experimental data[edit | edit source]
- experimentally validated: data available for COL, NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell: data available for COL
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]