Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2280 [new locus tag: SACOL_RS11985 ]
- pan locus tag?: SAUPAN005753000
- symbol: ureA
- pan gene symbol?: ureA
- synonym:
- product: urease subunit gamma
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2280 [new locus tag: SACOL_RS11985 ]
- symbol: ureA
- product: urease subunit gamma
- replicon: chromosome
- strand: +
- coordinates: 2341596..2341898
- length: 303
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237382 NCBI
- RefSeq: YP_187087 NCBI
- BioCyc: see SACOL_RS11985
- MicrobesOnline: 913762 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301TTGCATTTTACACAACGAGAGCAAGACAAATTAATGATTGTAGTGGCGGCGGAAGTTGCA
CGTCGTCGTAAAGCACGTGGTTTGAAACTAAATCATCCTGAGGCATTAGCTTTAATCAGC
GATGAATTATTAGAAGGTGCACGCGATGGTAAGACCGTTGCAGAGTTAATGAGTTATGGT
AGACAAATTCTAAACAAAGAAGATGTCATGGATGGTGTCGAACACATGATTACAGATATC
GAAATCGAGGCTACGTTCCCCGATGGTACTAAGTTAATCACAGTACATCACCCTATTGTT
TAA60
120
180
240
300
303
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2280 [new locus tag: SACOL_RS11985 ]
- symbol: UreA
- description: urease subunit gamma
- length: 100
- theoretical pI: 5.99184
- theoretical MW: 11273
- GRAVY: -0.233
⊟Function[edit | edit source]
- reaction: EC 3.5.1.5? ExPASyUrease Urea + H2O = CO2 + 2 NH3
- TIGRFAM: Central intermediary metabolism Nitrogen metabolism urease, gamma subunit (TIGR00193; EC 3.5.1.5; HMM-score: 155)
- TheSEED :
- Urease gamma subunit (EC 3.5.1.5)
Amino Acids and Derivatives Arginine; urea cycle, polyamines Urea decomposition Urease gamma subunit (EC 3.5.1.5)and 1 more - PFAM: no clan defined Urease_gamma; Urease, gamma subunit (PF00547; HMM-score: 157.8)and 1 morePilP (CL0655) CdsD_C; CdsD C-terminal (PF23862; HMM-score: 12.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9912
- Cytoplasmic Membrane Score: 0.0016
- Cell wall & surface Score: 0
- Extracellular Score: 0.0071
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00565
- TAT(Tat/SPI): 0.001991
- LIPO(Sec/SPII): 0.001087
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MHFTQREQDKLMIVVAAEVARRRKARGLKLNHPEALALISDELLEGARDGKTVAELMSYGRQILNKEDVMDGVEHMITDIEIEATFPDGTKLITVHHPIV
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell: 85 [3]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)