Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2285 [new locus tag: SACOL_RS12010 ]
- pan locus tag?: SAUPAN005758000
- symbol: ureG
- pan gene symbol?: ureG
- synonym:
- product: urease accessory protein UreG
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2285 [new locus tag: SACOL_RS12010 ]
- symbol: ureG
- product: urease accessory protein UreG
- replicon: chromosome
- strand: +
- coordinates: 2345194..2345808
- length: 615
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237387 NCBI
- RefSeq: YP_187092 NCBI
- BioCyc: see SACOL_RS12010
- MicrobesOnline: 913767 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601GTGGCAAATCCGATTAAAATTGGTATTGGTGGTCCTGTAGGTGCAGGTAAAACACAATTA
ATTGAAAAAGTTGTAAAACGTCTTTCAAAAGAAATGAGTATCGGCGTTATTACAAATGAT
ATATATACAAAAGAAGACGAAAAGATATTAGTAAATTCAGGAGTTCTACCTGAAAGTCGT
ATCATTGGTGTTGAAACTGGTGGATGTCCTCATACTGCGATTCGTGAAGATGCATCTATG
AACTTTGCAGCAATAGACGAATTATTAGAACGTCATGACGATATAGAACTAATTTTCATA
GAATCTGGTGGCGATAACTTAGCAGCAACATTTAGTCCAGAACTTGTTGACTTTTCAATA
TATATTATCGATGTTGCTCAAGGTGAAAAGATTCCACGTAAAGGTGGTCAAGGTATGATT
AAGTCAGATTTCTTTGTAATTAACAAAACTGATTTAGCTCCCTATGTAGGTGCATCATTA
GAACAAATGGCTGAAGATACTAAAGTATTTCGTGGTAAACGTCCATTTACTTTTACTAAC
TTAAAAACCGACGAAGGTTTGGATGAAGTTATCGATTGGATTGAACGCGACACTTTACTC
AAAGGATTATCATAA60
120
180
240
300
360
420
480
540
600
615
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2285 [new locus tag: SACOL_RS12010 ]
- symbol: UreG
- description: urease accessory protein UreG
- length: 204
- theoretical pI: 4.4618
- theoretical MW: 22344.4
- GRAVY: -0.115196
⊟Function[edit | edit source]
- TIGRFAM: Central intermediary metabolism Nitrogen metabolism urease accessory protein UreG (TIGR00101; HMM-score: 313)and 10 moreProtein fate Protein modification and repair hydrogenase accessory protein HypB (TIGR00073; HMM-score: 85.9)Purines, pyrimidines, nucleosides, and nucleotides Salvage of nucleosides and nucleotides uridine kinase (TIGR00235; EC 2.7.1.48; HMM-score: 21.7)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobalamin biosynthesis protein CobW (TIGR02475; HMM-score: 20.9)Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 20.3)Transport and binding proteins Amino acids, peptides and amines LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 17.2)Regulatory functions Protein interactions LAO/AO transport system ATPase (TIGR00750; EC 2.7.-.-; HMM-score: 17.2)Biosynthesis of cofactors, prosthetic groups, and carriers Molybdopterin molybdopterin-guanine dinucleotide biosynthesis protein B (TIGR00176; HMM-score: 13.6)Protein fate Protein and peptide secretion and trafficking putative secretion ATPase, PEP-CTERM locus subfamily (TIGR03015; HMM-score: 12.4)Protein fate Degradation of proteins, peptides, and glycopeptides ATP-dependent Clp protease ATP-binding subunit ClpA (TIGR02639; HMM-score: 10.9)DNA metabolism DNA replication, recombination, and repair orc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 10.6)
- TheSEED :
- Urease metallocenter assembly GTPase UreG
Amino Acids and Derivatives Arginine; urea cycle, polyamines Urea decomposition Urease accessory protein UreGand 1 more - PFAM: P-loop_NTPase (CL0023) cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 144.2)and 12 moreNTPase_1; NTPase (PF03266; HMM-score: 20.1)GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 15.8)MobB; Molybdopterin guanine dinucleotide synthesis protein B (PF03205; HMM-score: 14.6)KAP_NTPase; KAP family P-loop domain (PF07693; HMM-score: 14.2)AAA_18; AAA domain (PF13238; HMM-score: 14.1)ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13.7)MeaB; Methylmalonyl Co-A mutase-associated GTPase MeaB (PF03308; HMM-score: 13.4)RNA_helicase; RNA helicase (PF00910; HMM-score: 12.7)AAA_22; AAA domain (PF13401; HMM-score: 12.7)MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 12.2)TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 12)Zeta_toxin; Zeta toxin (PF06414; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9606
- Cytoplasmic Membrane Score: 0.0319
- Cell wall & surface Score: 0
- Extracellular Score: 0.0075
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.006482
- TAT(Tat/SPI): 0.000189
- LIPO(Sec/SPII): 0.000713
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MANPIKIGIGGPVGAGKTQLIEKVVKRLSKEMSIGVITNDIYTKEDEKILVNSGVLPESRIIGVETGGCPHTAIREDASMNFAAIDELLERHDDIELIFIESGGDNLAATFSPELVDFSIYIIDVAQGEKIPRKGGQGMIKSDFFVINKTDLAPYVGASLEQMAEDTKVFRGKRPFTFTNLKTDEGLDEVIDWIERDTLLKGLS
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3] [4]
- quantitative data / protein copy number per cell: 390 [5]
- interaction partners:
SACOL2657 (arcA) arginine deiminase [6] (data from MRSA252) SACOL0557 (cysK) cysteine synthase [6] (data from MRSA252) SACOL1016 (fabI) enoyl-ACP reductase [6] (data from MRSA252) SACOL1072 (folD) bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase [6] (data from MRSA252) SACOL1199 (ftsZ) cell division protein FtsZ [6] (data from MRSA252) SACOL0593 (fusA) elongation factor G [6] (data from MRSA252) SACOL1961 (gatA) aspartyl/glutamyl-tRNA amidotransferase subunit A [6] (data from MRSA252) SACOL2623 (mqo2) malate:quinone oxidoreductase [6] (data from MRSA252) SACOL1453 (murG) UDPdiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase [6] (data from MRSA252) SACOL1102 (pdhA) pyruvate dehydrogenase complex E1 component subunit alpha [6] (data from MRSA252) SACOL1104 (pdhC) branched-chain alpha-keto acid dehydrogenase E2 [6] (data from MRSA252) SACOL1105 (pdhD) dihydrolipoamide dehydrogenase [6] (data from MRSA252) SACOL2128 (pdp) pyrimidine-nucleoside phosphorylase [6] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [6] (data from MRSA252) SACOL1745 (pyk) pyruvate kinase [6] (data from MRSA252) SACOL2236 (rplB) 50S ribosomal protein L2 [6] (data from MRSA252) SACOL2224 (rplF) 50S ribosomal protein L6 [6] (data from MRSA252) SACOL0585 (rplJ) 50S ribosomal protein L10 [6] (data from MRSA252) SACOL1257 (rplS) 50S ribosomal protein L19 [6] (data from MRSA252) SACOL2234 (rplV) 50S ribosomal protein L22 [6] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [6] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [6] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [6] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [6] (data from MRSA252) SACOL2104 (upp) uracil phosphoribosyltransferase [6] (data from MRSA252) SACOL0731 LysR family transcriptional regulator [6] (data from MRSA252) SACOL0944 NADH dehydrogenase [6] (data from MRSA252) SACOL0973 fumarylacetoacetate hydrolase [6] (data from MRSA252) SACOL1759 universal stress protein [6] (data from MRSA252) SACOL2173 alkaline shock protein 23 [6] (data from MRSA252) SACOL2297 hypothetical protein [6] (data from MRSA252) SACOL2553 pyruvate oxidase [6] (data from MRSA252) SACOL2561 hydroxymethylglutaryl-CoA synthase [6] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 19.81 h [7]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 6.00 6.01 6.02 6.03 6.04 6.05 6.06 6.07 6.08 6.09 6.10 6.11 6.12 6.13 6.14 6.15 6.16 6.17 6.18 6.19 6.20 6.21 6.22 6.23 6.24 6.25 6.26 6.27 6.28 6.29 6.30 6.31 6.32 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)