Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2731 [new locus tag: SACOL_RS14275 ]
- pan locus tag?: SAUPAN006479000
- symbol: SACOL2731
- pan gene symbol?: cspB
- synonym:
- product: CSD family cold shock protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2731 [new locus tag: SACOL_RS14275 ]
- symbol: SACOL2731
- product: CSD family cold shock protein
- replicon: chromosome
- strand: +
- coordinates: 2801135..2801335
- length: 201
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238398 NCBI
- RefSeq: YP_187517 NCBI
- BioCyc: see SACOL_RS14275
- MicrobesOnline: 914197 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATAACGGTACAGTAAAATGGTTTAACGCAGAAAAAGGTTTTGGTTTCATCGAACAA
GAAAATGGCGGAGACGTATTCGTACATTTCTCAGGTATCGCTAGCGATGGCTACAAAACT
TTAGAAGAAGGTCAAAAAGTTACTTTCGAAATCACTGAAGGTCAACGTGGAGACCAAGCA
GTTAACGTACAAACTGTTTAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2731 [new locus tag: SACOL_RS14275 ]
- symbol: SACOL2731
- description: CSD family cold shock protein
- length: 66
- theoretical pI: 4.25084
- theoretical MW: 7257.87
- GRAVY: -0.512121
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions cold shock domain protein CspD (TIGR02381; HMM-score: 90.2)DNA metabolism DNA replication, recombination, and repair cold shock domain protein CspD (TIGR02381; HMM-score: 90.2)
- TheSEED :
- Cold shock protein of CSP family
- PFAM: OB (CL0021) CSD; 'Cold-shock' DNA-binding domain (PF00313; HMM-score: 102.1)and 5 moreCSDE1; Cold shock domain-containing protein E1 CSD domain (PF23456; HMM-score: 20.4)S1; S1 RNA binding domain (PF00575; HMM-score: 19.3)OB_RNB; Ribonuclease B OB domain (PF08206; HMM-score: 16)S1CSD-TOTE-2; S1/CSD-like domain 2 of the TOTE conflict systems (PF22707; HMM-score: 15.8)CusF_Ec; Copper binding periplasmic protein CusF (PF11604; HMM-score: 12.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9999
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.0001
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011033
- TAT(Tat/SPI): 0.000784
- LIPO(Sec/SPII): 0.001153
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNNGTVKWFNAEKGFGFIEQENGGDVFVHFSGIASDGYKTLEEGQKVTFEITEGQRGDQAVNVQTV
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 2208 [4]
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e)