Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS14275 [old locus tag: SACOL2731 ]
- pan locus tag?: SAUPAN006479000
- symbol: SACOL_RS14275
- pan gene symbol?: cspB
- synonym:
- product: cold-shock protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS14275 [old locus tag: SACOL2731 ]
- symbol: SACOL_RS14275
- product: cold-shock protein
- replicon: chromosome
- strand: +
- coordinates: 2801135..2801335
- length: 201
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAATAACGGTACAGTAAAATGGTTTAACGCAGAAAAAGGTTTTGGTTTCATCGAACAA
GAAAATGGCGGAGACGTATTCGTACATTTCTCAGGTATCGCTAGCGATGGCTACAAAACT
TTAGAAGAAGGTCAAAAAGTTACTTTCGAAATCACTGAAGGTCAACGTGGAGACCAAGCA
GTTAACGTACAAACTGTTTAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS14275 [old locus tag: SACOL2731 ]
- symbol: SACOL_RS14275
- description: cold-shock protein
- length: 66
- theoretical pI: 4.25084
- theoretical MW: 7257.87
- GRAVY: -0.512121
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions cold shock domain protein CspD (TIGR02381; HMM-score: 90.2)DNA metabolism DNA replication, recombination, and repair cold shock domain protein CspD (TIGR02381; HMM-score: 90.2)
- TheSEED: see SACOL2731
- PFAM: OB (CL0021) CSD; 'Cold-shock' DNA-binding domain (PF00313; HMM-score: 100.3)and 2 moreS1; S1 RNA binding domain (PF00575; HMM-score: 19.9)OB_RNB; Ribonuclease B OB domain (PF08206; HMM-score: 15.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011033
- TAT(Tat/SPI): 0.000784
- LIPO(Sec/SPII): 0.001153
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNNGTVKWFNAEKGFGFIEQENGGDVFVHFSGIASDGYKTLEEGQKVTFEITEGQRGDQAVNVQTV
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.