From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_2639 [new locus tag: SAUSA300_RS14655 ]
  • pan locus tag?: SAUPAN006479000
  • symbol: SAUSA300_2639
  • pan gene symbol?: cspB
  • synonym:
  • product: cold shock protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_2639 [new locus tag: SAUSA300_RS14655 ]
  • symbol: SAUSA300_2639
  • product: cold shock protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2864456..2864683
  • length: 228
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    GTGCAAAAGCACACGGAGGTTTTCTATATGAATAACGGTACAGTAAAATGGTTTAACGCA
    GAAAAAGGTTTTGGTTTCATCGAACAAGAAAATGGCGGAGACGTATTCGTACATTTCTCA
    GGTATCGCTAGCGATGGCTACAAAACTTTAGAAGAAGGTCAAAAAGTTACTTTCGAAATC
    ACTGAAGGTCAACGTGGAGACCAAGCAGTTAACGTACAAACTGTTTAA
    60
    120
    180
    228

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_2639 [new locus tag: SAUSA300_RS14655 ]
  • symbol: SAUSA300_2639
  • description: cold shock protein
  • length: 75
  • theoretical pI: 4.49458
  • theoretical MW: 8422.21
  • GRAVY: -0.546667

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Adaptations to atypical conditions cold shock domain protein CspD (TIGR02381; HMM-score: 89.6)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair cold shock domain protein CspD (TIGR02381; HMM-score: 89.6)
  • TheSEED  :
    • Cold shock protein of CSP family
    Stress Response Cold shock Cold shock, CspA family of proteins  Cold shock protein CspG
  • PFAM:
    OB (CL0021) CSD; 'Cold-shock' DNA-binding domain (PF00313; HMM-score: 99.8)
    and 2 more
    S1; S1 RNA binding domain (PF00575; HMM-score: 19.5)
    OB_RNB; Ribonuclease B OB domain (PF08206; HMM-score: 15.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.007798
    • TAT(Tat/SPI): 0.000374
    • LIPO(Sec/SPII): 0.000995
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MQKHTEVFYMNNGTVKWFNAEKGFGFIEQENGGDVFVHFSGIASDGYKTLEEGQKVTFEITEGQRGDQAVNVQTV

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_2639&oldid=75717"