From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_RS14655 [old locus tag: SAUSA300_2639 ]
  • pan locus tag?: SAUPAN006479000
  • symbol: SAUSA300_RS14655
  • pan gene symbol?: cspB
  • synonym:
  • product: cold-shock protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_RS14655 [old locus tag: SAUSA300_2639 ]
  • symbol: SAUSA300_RS14655
  • product: cold-shock protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2864483..2864683
  • length: 201
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAATAACGGTACAGTAAAATGGTTTAACGCAGAAAAAGGTTTTGGTTTCATCGAACAA
    GAAAATGGCGGAGACGTATTCGTACATTTCTCAGGTATCGCTAGCGATGGCTACAAAACT
    TTAGAAGAAGGTCAAAAAGTTACTTTCGAAATCACTGAAGGTCAACGTGGAGACCAAGCA
    GTTAACGTACAAACTGTTTAA
    60
    120
    180
    201


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_RS14655 [old locus tag: SAUSA300_2639 ]
  • symbol: SAUSA300_RS14655
  • description: cold-shock protein
  • length: 66
  • theoretical pI: 4.25084
  • theoretical MW: 7257.87
  • GRAVY: -0.512121

Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Adaptations to atypical conditions cold shock domain protein CspD (TIGR02381; HMM-score: 90.2)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair cold shock domain protein CspD (TIGR02381; HMM-score: 90.2)
  • TheSEED: see SAUSA300_2639
  • PFAM:
    OB (CL0021) CSD; 'Cold-shock' DNA-binding domain (PF00313; HMM-score: 102.1)
    and 5 more
    CSDE1; Cold shock domain-containing protein E1 CSD domain (PF23456; HMM-score: 20.4)
    S1; S1 RNA binding domain (PF00575; HMM-score: 19.3)
    OB_RNB; Ribonuclease B OB domain (PF08206; HMM-score: 16)
    S1CSD-TOTE-2; S1/CSD-like domain 2 of the TOTE conflict systems (PF22707; HMM-score: 15.8)
    CusF_Ec; Copper binding periplasmic protein CusF (PF11604; HMM-score: 12.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9999
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0001
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011033
    • TAT(Tat/SPI): 0.000784
    • LIPO(Sec/SPII): 0.001153
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MNNGTVKWFNAEKGFGFIEQENGGDVFVHFSGIASDGYKTLEEGQKVTFEITEGQRGDQAVNVQTV

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]