Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS05810 [old locus tag: SACOL1137 ]
- pan locus tag?: SAUPAN003356000
- symbol: SACOL_RS05810
- pan gene symbol?: rpmF
- synonym:
- product: 50S ribosomal protein L32
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS05810 [old locus tag: SACOL1137 ]
- symbol: SACOL_RS05810
- product: 50S ribosomal protein L32
- replicon: chromosome
- strand: +
- coordinates: 1145562..1145735
- length: 174
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGCAGTACCAAAAAGAAGAACTTCTAAAACTAGAAAAAACAAACGTCGTACGCATTTC
AAAATTTCAGTACCAGGTATGACTGAATGCCCAAACTGTGGCGAATACAAATTATCACAC
CGTGTATGTAAAAACTGTGGTTCTTACAATGGCGAAGAAGTAGCAGCTAAATAA60
120
174
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS05810 [old locus tag: SACOL1137 ]
- symbol: SACOL_RS05810
- description: 50S ribosomal protein L32
- length: 57
- theoretical pI: 10.6639
- theoretical MW: 6484.52
- GRAVY: -1.0614
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available