From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1027 [new locus tag: SAUSA300_RS05530 ]
  • pan locus tag?: SAUPAN003356000
  • symbol: rpmF
  • pan gene symbol?: rpmF
  • synonym:
  • product: 50S ribosomal protein L32

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1027 [new locus tag: SAUSA300_RS05530 ]
  • symbol: rpmF
  • product: 50S ribosomal protein L32
  • replicon: chromosome
  • strand: +
  • coordinates: 1122024..1122197
  • length: 174
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGGCAGTACCAAAAAGAAGAACTTCTAAAACTAGAAAAAACAAACGTCGTACGCATTTC
    AAAATTTCAGTACCAGGTATGACTGAATGCCCAAACTGTGGCGAATACAAATTATCACAC
    CGTGTATGTAAAAACTGTGGTTCTTACAATGGCGAAGAAGTAGCAGCTAAATAA
    60
    120
    174

Protein[edit | edit source]

Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU

General[edit | edit source]

  • locus tag: SAUSA300_1027 [new locus tag: SAUSA300_RS05530 ]
  • symbol: RpmF
  • description: 50S ribosomal protein L32
  • length: 57
  • theoretical pI: 10.6639
  • theoretical MW: 6484.52
  • GRAVY: -1.0614

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL32 (TIGR01031; HMM-score: 97.1)
    and 3 more
    Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage/conjugal plasmid C-4 type zinc finger protein, TraR family (TIGR02419; HMM-score: 13.3)
    Signal transduction Regulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 13.2)
    YgiT-type zinc finger domain (TIGR03831; HMM-score: 11.9)
  • TheSEED  :
    • LSU ribosomal protein L32p
    • LSU ribosomal protein L32p, zinc-dependent
    Protein Metabolism Protein biosynthesis Ribosome LSU bacterial  LSU ribosomal protein L32p
  • PFAM:
    Zn_Beta_Ribbon (CL0167) Ribosomal_L32p; Ribosomal L32p protein family (PF01783; HMM-score: 95.2)
    and 20 more
    Zn_ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 24.5)
    DZR; Double zinc ribbon (PF12773; HMM-score: 18.7)
    HypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 17.6)
    Zn_Ribbon_1; zinc-ribbon domain (PF13240; HMM-score: 17.3)
    Nop10p; Nucleolar RNA-binding protein, Nop10p family (PF04135; HMM-score: 15.4)
    Zn_ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 13.4)
    no clan defined PolC_DP2_central; DNA polymerase II large subunit DP2, central domain (PF24844; HMM-score: 13.1)
    Zf_1st_IFT121; IFT121, first zinc finger domain (PF23146; HMM-score: 13)
    C2H2-zf (CL0361) Znf_XAF1_N; XIAP-associated factor 1-like, N-terminal zinc finger (PF23580; HMM-score: 12.8)
    Zn_Beta_Ribbon (CL0167) DUF7577; Domain of unknown function (DUF7577) (PF24463; HMM-score: 12.8)
    Zn_Ribbon_TF; TFIIB zinc-binding (PF08271; HMM-score: 12.6)
    PFL-like (CL0339) NRDD; Anaerobic ribonucleoside-triphosphate reductase (PF13597; HMM-score: 12.3)
    no clan defined zf-tcix; Putative treble-clef, zinc-finger, Zn-binding (PF14952; HMM-score: 12.1)
    Zn_Beta_Ribbon (CL0167) Zn_ribbon_LapB; Rubredoxin metal binding domain (PF18073; HMM-score: 11.9)
    DUF7575; Domain of unknown function (DUF7575) (PF24460; HMM-score: 11.1)
    DUF7563; Family of unknown function (DUF7563) (PF24444; HMM-score: 10.7)
    no clan defined RUBY_RBDX; Rubrerythrin, rubredoxin-like domain (PF21349; HMM-score: 10.4)
    Zn_Beta_Ribbon (CL0167) Zn_ribbon_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 9.5)
    zinc_ribbon_6; zinc-ribbon (PF14599; HMM-score: 9.1)
    Zn_Ribbon_Prim; Zinc-binding domain of primase-helicase (PF08273; HMM-score: 8.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.6146
    • Cytoplasmic Membrane Score: 0
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.3854
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 0.67
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.295979
    • TAT(Tat/SPI): 0.014651
    • LIPO(Sec/SPII): 0.029993
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]