PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 26-AUG-2013

⊟Summary

• organism: Staphylococcus aureus N315
• locus tag: SAS033 [new locus tag: SA_RS05530 ]
• pan locus tag^?: SAUPAN003356000
• symbol: rpmF
• pan gene symbol^?: rpmF
• synonym:
• product: 50S ribosomal protein L32

⊟Genome View

⊟Gene

⊟General

• type: CDS
• locus tag: SAS033 [new locus tag: SA_RS05530 ]
• symbol: rpmF
• product: 50S ribosomal protein L32
• replicon: chromosome
• strand: +
• coordinates: 1104331..1104504
• length: 174
• essential: yes DEG other strains

⊟Accession numbers

• Gene ID: 1123802 NCBI
• RefSeq: NP_374245 NCBI
• BioCyc: see SA_RS05530
• MicrobesOnline: 103271 MicrobesOnline

⊟Phenotype

Share your knowledge and add information here. [edit]

⊟DNA sequence

• 1
  61
  121
  
  ATGGCAGTACCAAAAAGAAGAACTTCTAAAACTAGAAAAAACAAACGTCGTACGCATTTC
  AAAATTTCAGTACCAGGTATGACTGAATGCCCAAACTGTGGCGAATACAAATTATCACAC
  CGTGTATGTAAAAACTGTGGTTCTTACAATGGCGAAGAAGTAGCAGCTAAATAA
  60
  120
  174
  

⊟Protein

• 4WCE
  PDB
• 4WF9
  PDB
• 4WFA
  PDB
• 4WFB
  PDB
• 5HKV
  PDB
• 5HL7
  PDB
• 5LI0
  PDB
• 5ND8
  PDB
• 5ND9
  PDB
• 5NRG
  PDB
• 5TCU
  PDB

Protein Data Bank: 4WCE

Protein Data Bank: 4WF9

Protein Data Bank: 4WFA

Protein Data Bank: 4WFB

Protein Data Bank: 5HKV

Protein Data Bank: 5HL7

Protein Data Bank: 5LI0

Protein Data Bank: 5ND8

Protein Data Bank: 5ND9

Protein Data Bank: 5NRG

Protein Data Bank: 5TCU

⊟General

• locus tag: SAS033 [new locus tag: SA_RS05530 ]
• symbol: RpmF
• description: 50S ribosomal protein L32
• length: 57
• theoretical pI: 10.6639
• theoretical MW: 6484.52
• GRAVY: -1.0614

⊟Function

• TIGRFAM:
  Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL32 (TIGR01031; HMM-score: 97.1)
  and 3 more
  Genetic information processing Mobile and extrachromosomal element functions Prophage functions phage/conjugal plasmid C-4 type zinc finger protein, TraR family (TIGR02419; HMM-score: 13.3)
  Signal transduction Regulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 13.2)
  YgiT-type zinc finger domain (TIGR03831; HMM-score: 11.9)
• TheSEED  :
  • LSU ribosomal protein L32p
  • LSU ribosomal protein L32p, zinc-dependent
  Protein Metabolism Protein biosynthesis Ribosome LSU bacterial  LSU ribosomal protein L32p
• PFAM:
  Zn_Beta_Ribbon (CL0167) Ribosomal_L32p; Ribosomal L32p protein family (PF01783; HMM-score: 96.1)
  and 13 more
  zf-ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 20.5)
  DZR; Double zinc ribbon (PF12773; HMM-score: 19.1)
  zinc_ribbon_2; zinc-ribbon domain (PF13240; HMM-score: 17.4)
  no clan defined HypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 17)
  Zn_Beta_Ribbon (CL0167) Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 16)
  no clan defined zf-tcix; Putative treble-clef, zinc-finger, Zn-binding (PF14952; HMM-score: 14.5)
  Nop10p; Nucleolar RNA-binding protein, Nop10p family (PF04135; HMM-score: 14.3)
  PFL-like (CL0339) NRDD; Anaerobic ribonucleoside-triphosphate reductase (PF13597; HMM-score: 12.7)
  Zn_Beta_Ribbon (CL0167) TF_Zn_Ribbon; TFIIB zinc-binding (PF08271; HMM-score: 12.1)
  no clan defined PolC_DP2; DNA polymerase II large subunit DP2 (PF03833; HMM-score: 10.5)
  zinc_ribbon_6; Zinc-ribbon (PF14599; HMM-score: 10.4)
  Zn_Beta_Ribbon (CL0167) Prim_Zn_Ribbon; Zinc-binding domain of primase-helicase (PF08273; HMM-score: 7.3)
  DUF1610; Domain of unknown function (DUF1610) (PF07754; HMM-score: 6.5)

⊟Structure, modifications & cofactors

• domains:
• modifications:
• cofactors:
• effectors:

⊟Localization

• PSORTb: Cytoplasmic
  • Cytoplasmic Score: 10
  • Cytoplasmic Membrane Score: 0
  • Cellwall Score: 0
  • Extracellular Score: 0
  • Internal Helices: 0
• LocateP: Intracellular
  • Prediction by SwissProt Classification: Cytoplasmic
  • Pathway Prediction: No pathway
  • Intracellular possibility: 0.67
  • Signal peptide possibility: -0.5
  • N-terminally Anchored Score: 1
  • Predicted Cleavage Site: No CleavageSite
• SignalP: no predicted signal peptide
  • SP(Sec/SPI): 0.295979
  • TAT(Tat/SPI): 0.014651
  • LIPO(Sec/SPII): 0.029993
• predicted transmembrane helices (TMHMM): 0

⊟Accession numbers

• GI: 15926712 NCBI
• RefSeq: NP_374245 NCBI
• UniProt: P66210 UniProt

⊟Protein sequence

• MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK

⊟Experimental data

• experimentally validated:
• protein localization: data available for COL
• quantitative data / protein copy number per cell: data available for COL
• interaction partners:

⊟Expression & Regulation

⊟Operon

• MicrobesOnline: SA0975 > rpmF

⊟Regulation

• regulator:

⊟Transcription pattern

• S.aureus Expression Data Browser: data available for NCTC8325

⊟Protein synthesis (provided by Aureolib)

• Aureolib: no data available

⊟Protein stability

• half-life: no data available

⊟Biological Material

⊟Mutants

⊟Expression vector

⊟lacZ fusion

⊟GFP fusion

⊟two-hybrid system

⊟FLAG-tag construct

⊟Antibody

⊟Other Information

You are kindly invited to share additional interesting facts.

⊟Literature

⊟References

⊟Relevant publications