Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus USA300_FPR3757
- locus tag: SAUSA300_RS05530 [old locus tag: SAUSA300_1027 ]
- pan locus tag?: SAUPAN003356000
- symbol: SAUSA300_RS05530
- pan gene symbol?: rpmF
- synonym:
- product: 50S ribosomal protein L32
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAUSA300_RS05530 [old locus tag: SAUSA300_1027 ]
- symbol: SAUSA300_RS05530
- product: 50S ribosomal protein L32
- replicon: chromosome
- strand: +
- coordinates: 1122024..1122197
- length: 174
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_007793 (1122024..1122197) NCBI
- BioCyc: SAUSA300_RS05530 BioCyc
- MicrobesOnline: see SAUSA300_1027
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGGCAGTACCAAAAAGAAGAACTTCTAAAACTAGAAAAAACAAACGTCGTACGCATTTC
AAAATTTCAGTACCAGGTATGACTGAATGCCCAAACTGTGGCGAATACAAATTATCACAC
CGTGTATGTAAAAACTGTGGTTCTTACAATGGCGAAGAAGTAGCAGCTAAATAA60
120
174
⊟Protein[edit | edit source]
Protein Data Bank: 4WCE
Protein Data Bank: 4WF9
Protein Data Bank: 4WFA
Protein Data Bank: 4WFB
Protein Data Bank: 5HKV
Protein Data Bank: 5HL7
Protein Data Bank: 5LI0
Protein Data Bank: 5ND8
Protein Data Bank: 5ND9
Protein Data Bank: 5NRG
Protein Data Bank: 5TCU
⊟General[edit | edit source]
- locus tag: SAUSA300_RS05530 [old locus tag: SAUSA300_1027 ]
- symbol: SAUSA300_RS05530
- description: 50S ribosomal protein L32
- length: 57
- theoretical pI: 10.6639
- theoretical MW: 6484.52
- GRAVY: -1.0614
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis Ribosomal proteins: synthesis and modification ribosomal protein bL32 (TIGR01031; HMM-score: 97.1)and 3 moreMobile and extrachromosomal element functions Prophage functions phage/conjugal plasmid C-4 type zinc finger protein, TraR family (TIGR02419; HMM-score: 13.3)Regulatory functions DNA interactions putative regulatory protein, FmdB family (TIGR02605; HMM-score: 13.2)YgiT-type zinc finger domain (TIGR03831; HMM-score: 11.9)
- TheSEED: see SAUSA300_1027
- PFAM: Zn_Beta_Ribbon (CL0167) Ribosomal_L32p; Ribosomal L32p protein family (PF01783; HMM-score: 95.2)and 20 moreZn_ribbon_3; zinc-ribbon domain (PF13248; HMM-score: 24.5)DZR; Double zinc ribbon (PF12773; HMM-score: 18.7)HypA; Hydrogenase/urease nickel incorporation, metallochaperone, hypA (PF01155; HMM-score: 17.6)Zn_Ribbon_1; zinc-ribbon domain (PF13240; HMM-score: 17.3)Nop10p; Nucleolar RNA-binding protein, Nop10p family (PF04135; HMM-score: 15.4)Zn_ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 13.4)no clan defined PolC_DP2_central; DNA polymerase II large subunit DP2, central domain (PF24844; HMM-score: 13.1)Zf_1st_IFT121; IFT121, first zinc finger domain (PF23146; HMM-score: 13)C2H2-zf (CL0361) Znf_XAF1_N; XIAP-associated factor 1-like, N-terminal zinc finger (PF23580; HMM-score: 12.8)Zn_Beta_Ribbon (CL0167) DUF7577; Domain of unknown function (DUF7577) (PF24463; HMM-score: 12.8)Zn_Ribbon_TF; TFIIB zinc-binding (PF08271; HMM-score: 12.6)PFL-like (CL0339) NRDD; Anaerobic ribonucleoside-triphosphate reductase (PF13597; HMM-score: 12.3)no clan defined zf-tcix; Putative treble-clef, zinc-finger, Zn-binding (PF14952; HMM-score: 12.1)Zn_Beta_Ribbon (CL0167) Zn_ribbon_LapB; Rubredoxin metal binding domain (PF18073; HMM-score: 11.9)DUF7575; Domain of unknown function (DUF7575) (PF24460; HMM-score: 11.1)DUF7563; Family of unknown function (DUF7563) (PF24444; HMM-score: 10.7)no clan defined RUBY_RBDX; Rubrerythrin, rubredoxin-like domain (PF21349; HMM-score: 10.4)Zn_Beta_Ribbon (CL0167) Zn_ribbon_IS1595; Transposase zinc-ribbon domain (PF12760; HMM-score: 9.5)zinc_ribbon_6; zinc-ribbon (PF14599; HMM-score: 9.1)Zn_Ribbon_Prim; Zinc-binding domain of primase-helicase (PF08273; HMM-score: 8.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 10
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.6146
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0
- Extracellular Score: 0.3854
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.295979
- TAT(Tat/SPI): 0.014651
- LIPO(Sec/SPII): 0.029993
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
- GI: 446212617 NCBI
- RefSeq: WP_000290472 NCBI
- UniProt: see SAUSA300_1027
⊟Protein sequence[edit | edit source]
- MAVPKRRTSKTRKNKRRTHFKISVPGMTECPNCGEYKLSHRVCKNCGSYNGEEVAAK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]