From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS13220 [old locus tag: SACOL2524 ]
  • pan locus tag?: SAUPAN006149000
  • symbol: SACOL_RS13220
  • pan gene symbol?:
  • synonym:
  • product: MarR family transcriptional regulator

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS13220 [old locus tag: SACOL2524 ]
  • symbol: SACOL_RS13220
  • product: MarR family transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2585246..2585704
  • length: 459
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (2585246..2585704) NCBI
  • BioCyc: SACOL_RS13220 BioCyc
  • MicrobesOnline: see SACOL2524

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAAGAGAGAAGTTATTTTAAAATTACAACAATTTATTATAGAAAGAGAAAATGCCGAT
    AAAAGAAGACAGTATAAAAAGGAAAATGAGGAACTAGATTTATCTCTAACACAATTTCAT
    ATCATAGAGTTGATTGATAATAATGATAAAGTGAATAATAAATTTTTGTCTGAAATGTTA
    AATGTATCAAAACCAGCAATTACTAAATCGATAAAAAAACTTTTAGCGAAAGACTTAGTA
    GTTGAATCGCACAATGAATTTAACAAAAGAGAAGTTAATTATTCATTAACACAAAAAGGA
    AAAAAATTATCTTATATACATGATGAATTACATGAAAAATCGGTAAAAAAATATGAAGAG
    GTACTTAAAGTCTTTGATGATGATGAAATGGCAGTTATTATAGAGTTTTTAAACCGTAGT
    ATAGAAGAATTAAAAAAAGAAGATGGTTTAAATGATTAA
    60
    120
    180
    240
    300
    360
    420
    459


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS13220 [old locus tag: SACOL2524 ]
  • symbol: SACOL_RS13220
  • description: MarR family transcriptional regulator
  • length: 152
  • theoretical pI: 6.15058
  • theoretical MW: 18079.6
  • GRAVY: -0.765789

Function[edit | edit source]

  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 39.9)
    and 7 more
    Signal transduction Regulatory functions DNA interactions staphylococcal accessory regulator family (TIGR01889; HMM-score: 20.5)
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 20.5)
    EPS-associated transcriptional regulator, MarR family (TIGR04176; HMM-score: 17.2)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 16.5)
    Signal transduction Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 16.5)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.2)
    Signal transduction Regulatory functions DNA interactions transcriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 14.7)
  • TheSEED: see SACOL2524
  • PFAM:
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 47.7)
    and 17 more
    MarR_2; MarR family (PF12802; HMM-score: 34.9)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 31.7)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 29.2)
    Staph_reg_Sar_Rot; Transcriptional regulator SarA/Rot (PF22381; HMM-score: 27.3)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 26.6)
    HxlR; HxlR-like helix-turn-helix (PF01638; HMM-score: 24.8)
    HTH_11; HTH domain (PF08279; HMM-score: 23.9)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 23.2)
    HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 19)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 15.6)
    SMC_ScpB; Segregation and condensation complex subunit ScpB (PF04079; HMM-score: 15.2)
    Phage_rep_O; Bacteriophage replication protein O (PF04492; HMM-score: 14.4)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 13.9)
    GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 13.2)
    no clan defined TINF2_N; TERF1-interacting nuclear factor 2 N-terminus (PF14973; HMM-score: 12.2)
    DUF763; Protein of unknown function (DUF763) (PF05559; HMM-score: 10.1)
    SieB; Super-infection exclusion protein B (PF14163; HMM-score: 7.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9288
    • Cytoplasmic Membrane Score: 0.0052
    • Cell wall & surface Score: 0.001
    • Extracellular Score: 0.065
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.006685
    • TAT(Tat/SPI): 0.000219
    • LIPO(Sec/SPII): 0.00043
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKREVILKLQQFIIERENADKRRQYKKENEELDLSLTQFHIIELIDNNDKVNNKFLSEMLNVSKPAITKSIKKLLAKDLVVESHNEFNKREVNYSLTQKGKKLSYIHDELHEKSVKKYEEVLKVFDDDEMAVIIEFLNRSIEELKKEDGLND

Experimental data[edit | edit source]

  • experimentally validated: see SACOL2524
  • protein localization: see SACOL2524
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]