From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00104
  • pan locus tag?: SAUPAN000956000
  • symbol: SAOUHSC_00104
  • pan gene symbol?: phnC
  • synonym:
  • product: amino acid ABC transporter ATP-binding protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00104
  • symbol: SAOUHSC_00104
  • product: amino acid ABC transporter ATP-binding protein
  • replicon: chromosome
  • strand: -
  • coordinates: 108121..108894
  • length: 774
  • essential: no DEG other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAGTCAAATCGAATTTAAAAACGTCAGTAAAGTCTATCCTAACGGTCATGTAGGCTTG
    AAAAATATTAACTTAAATATTGAAAAAGGTGAATTTGCAGTTATTGTCGGACTATCTGGT
    GCTGGGAAATCCACGTTATTAAGATCTGTAAATCGTTTGCATGATATCACGTCAGGTGAA
    ATTTTCATCCAAGGTAAATCAATCACTAAAGCCCATGGTAAAGCATTATTAGAAATGCGC
    CGAAATATAGGTATGATTTTCCAACATTTTAATTTAGTTAAACGGTCAAGTGTATTACGA
    AATGTACTAAGTGGACGTGTAGGTTATCACCCTACTTGGAAAATGGTATTAGGTTTATTC
    CCAAAAGAAGACAAAATTAAGGCAATGGATGCACTAGAACGCGTCAATATCTTAGATAAA
    TATAATCAACGCTCTGATGAATTATCAGGTGGCCAACAACAACGTATATCTATTGCACGT
    GCGCTATGCCAAGAATCTGAAATTATTCTTGCAGATGAACCAGTTGCTTCATTAGACCCA
    TTAACTACGAAACAGGTTATGGATGATTTAAGAAAAATCAACCAAGAATTAGGCATCACA
    ATTTTAATTAATTTACATTTTGTTGACTTGGCAAAAGAATATGGCACACGCATCATTGGT
    TTACGTGATGGTGAAGTTGTCTATGATGGTCCTGCATCTGAAGCAACAGATGACGTATTT
    AGTGAAATATATGGACGTACAATTAAAGAAGATGAAAAGCTAGGAGTGAACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    774

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAOUHSC_00104
  • symbol: SAOUHSC_00104
  • description: amino acid ABC transporter ATP-binding protein
  • length: 257
  • theoretical pI: 8.43013
  • theoretical MW: 28688.8
  • GRAVY: -0.225292

⊟Function[edit | edit source]

  • reaction:
    EC 3.6.3.28?  ExPASy
    Phosphonate-transporting ATPase ATP + H2O + phosphonate(Out) = ADP + phosphate + phosphonate(In)
  • TIGRFAM:
    Metabolism Transport and binding proteins Anions phosphonate ABC transporter, ATP-binding protein (TIGR02315; EC 3.6.3.28; HMM-score: 372.3)
    and 73 more
    Cellular processes Cellular processes Cell division cell division ATP-binding protein FtsE (TIGR02673; HMM-score: 175.4)
    Metabolism Transport and binding proteins Amino acids, peptides and amines glycine betaine/L-proline transport ATP binding subunit (TIGR01186; HMM-score: 174.7)
    D-methionine ABC transporter, ATP-binding protein (TIGR02314; EC 3.6.3.-; HMM-score: 162.4)
    Metabolism Transport and binding proteins Amino acids, peptides and amines choline ABC transporter, ATP-binding protein (TIGR03415; HMM-score: 153.1)
    Metabolism Transport and binding proteins Anions phosphate ABC transporter, ATP-binding protein (TIGR00972; EC 3.6.3.27; HMM-score: 151.8)
    ABC exporter ATP-binding subunit, DevA family (TIGR02982; HMM-score: 149.3)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04521; EC 3.6.3.-; HMM-score: 145.1)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking lipoprotein releasing system, ATP-binding protein (TIGR02211; EC 3.6.3.-; HMM-score: 144.6)
    Cellular processes Cellular processes Toxin production and resistance putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 144.2)
    Metabolism Transport and binding proteins Unknown substrate putative bacteriocin export ABC transporter, lactococcin 972 group (TIGR03608; HMM-score: 144.2)
    ectoine/hydroxyectoine ABC transporter, ATP-binding protein EhuA (TIGR03005; HMM-score: 141.7)
    Metabolism Transport and binding proteins Unknown substrate energy-coupling factor transporter ATPase (TIGR04520; EC 3.6.3.-; HMM-score: 136.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system (TIGR03864; HMM-score: 128.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein (TIGR03265; HMM-score: 126.5)
    Metabolism Transport and binding proteins Anions sulfate ABC transporter, ATP-binding protein (TIGR00968; EC 3.6.3.25; HMM-score: 126.2)
    thiol reductant ABC exporter, CydD subunit (TIGR02857; HMM-score: 120.6)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikE (TIGR02769; EC 3.6.3.24; HMM-score: 118.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 114.2)
    Metabolism Transport and binding proteins Cations and iron carrying compounds cobalt ABC transporter, ATP-binding protein (TIGR01166; HMM-score: 113)
    Cellular processes Cellular processes Pathogenesis type I secretion system ATPase (TIGR03375; HMM-score: 112.9)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR03375; HMM-score: 112.9)
    Metabolism Transport and binding proteins Amino acids, peptides and amines polyamine ABC transporter, ATP-binding protein (TIGR01187; EC 3.6.3.31; HMM-score: 109.8)
    Metabolism Transport and binding proteins Other daunorubicin resistance ABC transporter, ATP-binding protein (TIGR01188; HMM-score: 109.3)
    Metabolism Transport and binding proteins Other thiamine ABC transporter, ATP-binding protein (TIGR01277; EC 3.6.3.-; HMM-score: 108.9)
    Metabolism Transport and binding proteins Anions molybdate ABC transporter, ATP-binding protein (TIGR02142; EC 3.6.3.29; HMM-score: 105.5)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 105.1)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, ATP-binding protein (TIGR03797; HMM-score: 105.1)
    Metabolism Transport and binding proteins Anions nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 104.9)
    Metabolism Transport and binding proteins Other nitrate ABC transporter, ATP-binding proteins C and D (TIGR01184; HMM-score: 104.9)
    2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT (TIGR03258; HMM-score: 104.4)
    thiol reductant ABC exporter, CydC subunit (TIGR02868; HMM-score: 104.1)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 103.4)
    Metabolism Transport and binding proteins Other lipid A export permease/ATP-binding protein MsbA (TIGR02203; HMM-score: 103.4)
    ABC transporter, permease/ATP-binding protein (TIGR02204; HMM-score: 103.3)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01846; HMM-score: 101.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtD (TIGR03411; HMM-score: 101.2)
    proposed F420-0 ABC transporter, ATP-binding protein (TIGR03873; HMM-score: 99.3)
    Metabolism Energy metabolism Methanogenesis methyl coenzyme M reductase system, component A2 (TIGR03269; HMM-score: 98.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.9)
    Genetic information processing Protein fate Protein modification and repair ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.9)
    Metabolism Transport and binding proteins Other ABC-type bacteriocin transporter (TIGR01193; HMM-score: 97.9)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 95.6)
    Metabolism Transport and binding proteins Unknown substrate anchored repeat-type ABC transporter, ATP-binding subunit (TIGR03771; HMM-score: 92.4)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 91.8)
    Metabolism Transport and binding proteins Other LPS export ABC transporter ATP-binding protein (TIGR04406; HMM-score: 91.8)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids glucan exporter ATP-binding protein (TIGR01192; EC 3.6.3.42; HMM-score: 86.3)
    Metabolism Transport and binding proteins Cations and iron carrying compounds nickel import ATP-binding protein NikD (TIGR02770; HMM-score: 83.6)
    lantibiotic protection ABC transporter, ATP-binding subunit (TIGR03740; HMM-score: 82.1)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids D-xylose ABC transporter, ATP-binding protein (TIGR02633; EC 3.6.3.17; HMM-score: 81.4)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion system ATPase (TIGR01842; HMM-score: 80.5)
    Cellular processes Cellular processes Biosynthesis of natural products NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 79.8)
    Metabolism Transport and binding proteins Amino acids, peptides and amines NHLM bacteriocin system ABC transporter, peptidase/ATP-binding protein (TIGR03796; HMM-score: 79.8)
    Metabolism Transport and binding proteins Other antigen peptide transporter 2 (TIGR00958; HMM-score: 79.2)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 79.2)
    Metabolism Transport and binding proteins Other heme ABC exporter, ATP-binding protein CcmA (TIGR01189; EC 3.6.3.41; HMM-score: 79.2)
    Cellular processes Cellular processes Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 73.7)
    Metabolism Transport and binding proteins Other nodulation ABC transporter NodI (TIGR01288; HMM-score: 73.7)
    Metabolism Transport and binding proteins Other rim ABC transporter (TIGR01257; HMM-score: 68.6)
    gliding motility-associated ABC transporter ATP-binding subunit GldA (TIGR03522; HMM-score: 68.5)
    Metabolism Transport and binding proteins Other pigment precursor permease (TIGR00955; HMM-score: 66.3)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate C-P lyase system protein PhnK (TIGR02323; HMM-score: 64.6)
    Metabolism Transport and binding proteins Other multi drug resistance-associated protein (MRP) (TIGR00957; HMM-score: 62.7)
    Metabolism Transport and binding proteins Anions cystic fibrosis transmembrane conductor regulator (CFTR) (TIGR01271; EC 3.6.3.49; HMM-score: 60.6)
    Metabolism Transport and binding proteins Amino acids, peptides and amines cyclic peptide transporter (TIGR01194; HMM-score: 55)
    Metabolism Transport and binding proteins Other cyclic peptide transporter (TIGR01194; HMM-score: 55)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly ATPase SufC (TIGR01978; HMM-score: 54.4)
    ATP-binding cassette protein, ChvD family (TIGR03719; HMM-score: 50.5)
    Metabolism Transport and binding proteins Carbohydrates, organic alcohols, and acids peroxysomal long chain fatty acyl transporter (TIGR00954; HMM-score: 41.8)
    Metabolism Transport and binding proteins Other pleiotropic drug resistance family protein (TIGR00956; HMM-score: 38.6)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair excinuclease ABC subunit A (TIGR00630; EC 3.1.25.-; HMM-score: 35.5)
    Ti-type conjugative transfer relaxase TraA (TIGR02768; HMM-score: 13.1)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 12.9)
    Metabolism Central intermediary metabolism Phosphorus compounds phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN (TIGR02322; HMM-score: 12.7)
  • TheSEED  :
    • ABC transporter, ATP-binding protein (cluster 12, methionine/phosphonates)
    Membrane Transport ABC transporters ABC transporter alkylphosphonate (TC 3.A.1.9.1)  Phosphonate ABC transporter ATP-binding protein (TC 3.A.1.9.1)
  • PFAM:
    P-loop_NTPase (CL0023) ABC_tran; ABC transporter (PF00005; HMM-score: 115.9)
    and 18 more
    AAA_21; AAA domain, putative AbiEii toxin, Type IV TA system (PF13304; HMM-score: 22.9)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 21.3)
    AAA_22; AAA domain (PF13401; HMM-score: 20.7)
    AAA_30; AAA domain (PF13604; HMM-score: 18.1)
    SMC_N; RecF/RecN/SMC N terminal domain (PF02463; HMM-score: 17.6)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 17.4)
    AAA_23; AAA domain (PF13476; HMM-score: 17.1)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 16.7)
    AAA_33; AAA domain (PF13671; HMM-score: 16.7)
    MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 15.6)
    ABC_ATPase; Predicted ATPase of the ABC class (PF09818; HMM-score: 14.6)
    AAA_27; AAA domain (PF13514; HMM-score: 14.6)
    AAA_25; AAA domain (PF13481; HMM-score: 14.3)
    AAA_18; AAA domain (PF13238; HMM-score: 13.7)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13.3)
    PEP-carboxyk (CL0374) PEPCK_ATP; Phosphoenolpyruvate carboxykinase (PF01293; HMM-score: 11.1)
    P-loop_NTPase (CL0023) G-alpha; G-protein alpha subunit (PF00503; HMM-score: 11)
    AAA_15; AAA ATPase domain (PF13175; HMM-score: 10.6)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.05
    • Cytoplasmic Membrane Score: 8.78
    • Cellwall Score: 0.08
    • Extracellular Score: 0.09
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004142
    • TAT(Tat/SPI): 0.0004
    • LIPO(Sec/SPII): 0.000402
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSQIEFKNVSKVYPNGHVGLKNINLNIEKGEFAVIVGLSGAGKSTLLRSVNRLHDITSGEIFIQGKSITKAHGKALLEMRRNIGMIFQHFNLVKRSSVLRNVLSGRVGYHPTWKMVLGLFPKEDKIKAMDALERVNILDKYNQRSDELSGGQQQRISIARALCQESEIILADEPVASLDPLTTKQVMDDLRKINQELGITILINLHFVDLAKEYGTRIIGLRDGEVVYDGPASEATDDVFSEIYGRTIKEDEKLGVN

⊟Experimental data[edit | edit source]

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 1.14 1.15 1.16 1.17 1.18 1.19 1.20 1.21 1.22 1.23 1.24 1.25 1.26 1.27 1.28 1.29 1.30 1.31 1.32 1.33 1.34 1.35 1.36 1.37 1.38 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  2. ↑ Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAOUHSC_00104&oldid=96669"