From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00341
  • pan locus tag?: SAUPAN001903000
  • symbol: SAOUHSC_00341
  • pan gene symbol?: metI
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00341
  • symbol: SAOUHSC_00341
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 355117..356220
  • length: 1104
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGAAGGATACACAGTTAGCCCAAATCACATTAACCGATGATTCAACCGGTGCTATAGCG
    AATCCAATCCATTTATCTACTGCCTACAAGCATCCAAAACTAGGACAATCGACAGGTTTT
    GATTATACACGTACTAAAAATCCTACACGCTCAACATTTGAAACCTGTTTTGCCAAACTT
    GAGCATGGTATTGCATCATTCGCTACATCAAGTGGAATGTCAGCCATTCAATTAATATGT
    AATCTATTTAAACCTCATGATGAAATTTTAGTTTCATTCGATTTATATGGTGGCACATTT
    AGATTATTTGAATTTTACGAGCAACAATACGATATCAAATTTAAGTACGTTGATTTTACA
    GATTATGAACAAGTTGAAAAAGAAATCACTGATAAAACAGTTGCATTATTCATTGAACCA
    ATATCTAACCCACAAATGATTGCTATTGATGTAAAGCCATACTATCAACTTTGTAAAGCT
    AAAGGCTTATTGTCAATTATCGACAATACTTTTTTAACACCTTATCTTTCAACACCACTA
    GCAGAAGGTGCTGATATAGTCTTACATTCAGCCACGAAATATATTGGCGGACATAACGAT
    GTACTAGCAGGTGTCGTAACCGTCAAAGATGAATCACTCGCGCAACAGTTGTTTGATTTT
    CACAACATGACTGGCGCAACACTTTCACCAATAGATAGTTATTTGTTGTTACGTGGACTT
    AAAACTTTGCATTTACGCATTGAGCGTGCGCAATCAAACGCTAGAAAACTTGCTAAAAAA
    TGTCAGTCACTTCAAGCAATTGACGAAGTACTATATAGCGGGCAAACTGGCATGCTTAGT
    TTAAGACTTAACAAGGCCTATAGCGTCGCTAAATTATTAGAAAATTTAGACATTTGCATT
    TTTGCAGAAAGTTTAGGAGGTACTGAAACATTAGTGACCTTCCCTTACACCCAAACACAT
    GTTGATATGCCAGATGCTGAAAAAGATAAACGTGGCATTGATGAGTATTTAATCCGCTTA
    TCACTAGGTGTTGAAAATTATGAAGACATCGAACGCGATATCATCCAAGCATTAGATAAA
    GCTCAGATTGGAGAGATTGTATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1104

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00341
  • symbol: SAOUHSC_00341
  • description: hypothetical protein
  • length: 367
  • theoretical pI: 5.01375
  • theoretical MW: 41071.6
  • GRAVY: -0.134332

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Amino acid biosynthesis Aspartate family O-succinylhomoserine (thiol)-lyase (TIGR02080; EC 2.5.1.48; HMM-score: 312.8)
    Metabolism Energy metabolism Amino acids and amines methionine gamma-lyase (TIGR01328; EC 4.4.1.11; HMM-score: 280.4)
    cystathionine beta-lyase (TIGR01329; EC 4.4.1.8; HMM-score: 277.7)
    and 8 more
    Metabolism Amino acid biosynthesis Aspartate family O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 241.8)
    Metabolism Amino acid biosynthesis Serine family O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 241.8)
    Metabolism Amino acid biosynthesis Aspartate family O-succinylhomoserine sulfhydrylase (TIGR01325; EC 4.2.99.-; HMM-score: 237.2)
    Metabolism Amino acid biosynthesis Aspartate family cystathionine beta-lyase (TIGR01324; EC 4.4.1.8; HMM-score: 129.3)
    transaminase, acetylornithine/succinylornithine family (TIGR00707; HMM-score: 17.7)
    Unknown function Enzymes of unknown specificity cysteine desulfurase family protein (TIGR01977; HMM-score: 17.7)
    Unknown function Enzymes of unknown specificity uncharacterized pyridoxal phosphate-dependent enzyme (TIGR01437; HMM-score: 14.3)
    Metabolism Energy metabolism Amino acids and amines succinylornithine transaminase family (TIGR03246; EC 2.6.1.81; HMM-score: 12.6)
  • TheSEED:  
    Amino Acids and Derivatives Lysine, threonine, methionine, and cysteine Methionine Biosynthesis  Cystathionine gamma-synthase (EC 2.5.1.48)
    and 1 more
    Sulfur Metabolism Organic sulfur assimilation L-Cystine Uptake and Metabolism  Cystathionine gamma-synthase (EC 2.5.1.48)
  • PFAM:
    PLP_aminotran (CL0061) Cys_Met_Meta_PP; Cys/Met metabolism PLP-dependent enzyme (PF01053; HMM-score: 371.1)
    and 2 more
    Aminotran_1_2; Aminotransferase class I and II (PF00155; HMM-score: 24.6)
    Aminotran_5; Aminotransferase class-V (PF00266; HMM-score: 21.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: pyridoxal 5'-phosphate
  • effectors:
  • protein partners:
    SAOUHSC_01683(dnaK)molecular chaperone DnaK  [1] (data from MRSA252)
    SAOUHSC_00799(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    SAOUHSC_02496(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    SAOUHSC_00521(rplL)50S ribosomal protein L7/L12  [1] (data from MRSA252)
    SAOUHSC_01784(rplT)50S ribosomal protein L20  [1] (data from MRSA252)
    SAOUHSC_01757(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SAOUHSC_02477(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    SAOUHSC_01234(tsf)elongation factor Ts  [1] (data from MRSA252)
    SAOUHSC_00187formate acetyltransferase  [1] (data from MRSA252)
    SAOUHSC_00530elongation factor Tu  [1] (data from MRSA252)
    SAOUHSC_01040pyruvate dehydrogenase complex, E1 component subunit alpha  [1] (data from MRSA252)
    SAOUHSC_01041pyruvate dehydrogenase complex, E1 component subunit beta  [1] (data from MRSA252)
    SAOUHSC_01042branched-chain alpha-keto acid dehydrogenase subunit E2  [1] (data from MRSA252)
    SAOUHSC_01806pyruvate kinase  [1] (data from MRSA252)

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.032735
    • TAT(Tat/SPI): 0.002987
    • LIPO(Sec/SPII): 0.002616
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKDTQLAQITLTDDSTGAIANPIHLSTAYKHPKLGQSTGFDYTRTKNPTRSTFETCFAKLEHGIASFATSSGMSAIQLICNLFKPHDEILVSFDLYGGTFRLFEFYEQQYDIKFKYVDFTDYEQVEKEITDKTVALFIEPISNPQMIAIDVKPYYQLCKAKGLLSIIDNTFLTPYLSTPLAEGADIVLHSATKYIGGHNDVLAGVVTVKDESLAQQLFDFHNMTGATLSPIDSYLLLRGLKTLHLRIERAQSNARKLAKKCQSLQAIDEVLYSGQTGMLSLRLNKAYSVAKLLENLDICIFAESLGGTETLVTFPYTQTHVDMPDAEKDKRGIDEYLIRLSLGVENYEDIERDIIQALDKAQIGEIV

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: T-box(Met) (transcription antitermination) regulon
    T-box(Met)(5' cis-acting region)important in Amino acid metabolism; compare RegPrecise for N315  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  2. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]