From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0431 [new locus tag: SACOL_RS02170 ]
  • pan locus tag?: SAUPAN001903000
  • symbol: SACOL0431
  • pan gene symbol?: metI
  • synonym:
  • product: trans-sulfuration enzyme family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0431 [new locus tag: SACOL_RS02170 ]
  • symbol: SACOL0431
  • product: trans-sulfuration enzyme family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 437181..438284
  • length: 1104
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGAAGGATACACAGTTAGCCCAAATCACATTAACCGATGATTCAACCGGTGCTATAGCG
    AATCCAATCCATTTATCTACTGCCTACAAGCATCCAAAACTAGGACAATCGACAGGTTTT
    GATTATACACGTACTAAAAATCCTACACGCTCAACATTTGAAACCTGTTTTGCCAAACTT
    GAGCATGGTATTGCATCATTCGCTACATCAAGTGGAATGTCAGCCATTCAATTAATATGT
    AATCTATTTAAACCTCATGATGAAATTTTAGTTTCATTCGATTTATATGGTGGCACATTT
    AGATTATTTGAATTTTACGAGCAACAATACGATATCAAATTTAAGTACGTTGATTTTACA
    GATTATGAACAAGTTGAAAAAGAAATCACTGATAAAACAGTTGCATTATTCATTGAACCA
    ATATCTAACCCACAAATGATTGCTATTGATGTAAAGCCATACTATCAACTTTGTAAAGCT
    AAAGGCTTATTGTCAATTATCGACAATACTTTTTTAACACCTTATCTTTCAACACCACTA
    GCAGAAGGTGCTGATATAGTCTTACATTCAGCCACGAAATATATTGGCGGACATAACGAT
    GTACTAGCAGGTGTCGTAACCGTCAAAGATGAATCACTCGCGCAACAGTTGTTTGATTTT
    CACAACATGACTGGCGCAACACTTTCACCAATAGATAGTTATTTGTTGTTACGTGGACTT
    AAAACTTTGCATTTACGCATTGAGCGTGCGCAATCAAACGCTAGAAAACTTGCTAAAAAA
    TGTCAGTCACTTCAAGCAATTGACGAAGTACTATATAGCGGGCAAACTGGCATGCTTAGT
    TTAAGACTTAACAAGGCCTATAGCGTCGCTAAATTATTAGAAAATTTAGACATTTGCATT
    TTTGCAGAAAGTTTAGGAGGTACTGAAACATTAGTGACCTTCCCTTACACCCAAACACAT
    GTTGATATGCCAGATGCTGAAAAAGATAAACGTGGCATTGATGAGTATTTAATCCGCTTA
    TCACTAGGTGTTGAAAATTATGAAGACATCGAACGCGATATCATCCAAGCATTAGATAAA
    GCTCAGATTGGAGAGATTGTATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1104

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0431 [new locus tag: SACOL_RS02170 ]
  • symbol: SACOL0431
  • description: trans-sulfuration enzyme family protein
  • length: 367
  • theoretical pI: 5.01375
  • theoretical MW: 41071.6
  • GRAVY: -0.134332

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Amino acid biosynthesis Aspartate family O-succinylhomoserine (thiol)-lyase (TIGR02080; EC 2.5.1.48; HMM-score: 312.8)
    Metabolism Energy metabolism Amino acids and amines methionine gamma-lyase (TIGR01328; EC 4.4.1.11; HMM-score: 280.4)
    cystathionine beta-lyase (TIGR01329; EC 4.4.1.8; HMM-score: 277.7)
    and 8 more
    Metabolism Amino acid biosynthesis Aspartate family O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 241.8)
    Metabolism Amino acid biosynthesis Serine family O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase (TIGR01326; HMM-score: 241.8)
    Metabolism Amino acid biosynthesis Aspartate family O-succinylhomoserine sulfhydrylase (TIGR01325; EC 4.2.99.-; HMM-score: 237.2)
    Metabolism Amino acid biosynthesis Aspartate family cystathionine beta-lyase (TIGR01324; EC 4.4.1.8; HMM-score: 129.3)
    transaminase, acetylornithine/succinylornithine family (TIGR00707; HMM-score: 17.7)
    Unknown function Enzymes of unknown specificity cysteine desulfurase family protein (TIGR01977; HMM-score: 17.7)
    Unknown function Enzymes of unknown specificity uncharacterized pyridoxal phosphate-dependent enzyme (TIGR01437; HMM-score: 14.3)
    Metabolism Energy metabolism Amino acids and amines succinylornithine transaminase family (TIGR03246; EC 2.6.1.81; HMM-score: 12.6)
  • TheSEED:  
    Amino Acids and Derivatives Lysine, threonine, methionine, and cysteine Methionine Biosynthesis  Cystathionine gamma-synthase (EC 2.5.1.48)
    and 1 more
    Sulfur Metabolism Organic sulfur assimilation L-Cystine Uptake and Metabolism  Cystathionine gamma-synthase (EC 2.5.1.48)
  • PFAM:
    PLP_aminotran (CL0061) Cys_Met_Meta_PP; Cys/Met metabolism PLP-dependent enzyme (PF01053; HMM-score: 371.1)
    and 2 more
    Aminotran_1_2; Aminotransferase class I and II (PF00155; HMM-score: 24.6)
    Aminotran_5; Aminotransferase class-V (PF00266; HMM-score: 21.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: pyridoxal 5'-phosphate
  • effectors:
  • protein partners:
    SACOL1637(dnaK)molecular chaperone DnaK  [1] (data from MRSA252)
    SACOL0842(eno)phosphopyruvate hydratase  [1] (data from MRSA252)
    SACOL1102(pdhA)pyruvate dehydrogenase complex E1 component subunit alpha  [1] (data from MRSA252)
    SACOL1103(pdhB)pyruvate dehydrogenase complex E1 component subunit beta  [1] (data from MRSA252)
    SACOL1104(pdhC)branched-chain alpha-keto acid dehydrogenase E2  [1] (data from MRSA252)
    SACOL0204(pflB)formate acetyltransferase  [1] (data from MRSA252)
    SACOL1745(pyk)pyruvate kinase  [1] (data from MRSA252)
    SACOL2224(rplF)50S ribosomal protein L6  [1] (data from MRSA252)
    SACOL0586(rplL)50S ribosomal protein L7/L12  [1] (data from MRSA252)
    SACOL1725(rplT)50S ribosomal protein L20  [1] (data from MRSA252)
    SACOL1702(rplU)50S ribosomal protein L21  [1] (data from MRSA252)
    SACOL2206(rpsI)30S ribosomal protein S9  [1] (data from MRSA252)
    SACOL1276(tsf)elongation factor Ts  [1] (data from MRSA252)
    SACOL0594(tuf)elongation factor Tu  [1] (data from MRSA252)

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.032735
    • TAT(Tat/SPI): 0.002987
    • LIPO(Sec/SPII): 0.002616
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKDTQLAQITLTDDSTGAIANPIHLSTAYKHPKLGQSTGFDYTRTKNPTRSTFETCFAKLEHGIASFATSSGMSAIQLICNLFKPHDEILVSFDLYGGTFRLFEFYEQQYDIKFKYVDFTDYEQVEKEITDKTVALFIEPISNPQMIAIDVKPYYQLCKAKGLLSIIDNTFLTPYLSTPLAEGADIVLHSATKYIGGHNDVLAGVVTVKDESLAQQLFDFHNMTGATLSPIDSYLLLRGLKTLHLRIERAQSNARKLAKKCQSLQAIDEVLYSGQTGMLSLRLNKAYSVAKLLENLDICIFAESLGGTETLVTFPYTQTHVDMPDAEKDKRGIDEYLIRLSLGVENYEDIERDIIQALDKAQIGEIV

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [2] [3] [4]
    quantitative data / protein copy number per cell: 7918 [5]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: T-box(Met) (transcription antitermination) regulon
    T-box(Met)(RNA)important in Amino acid metabolism; regulatory site identified based on RegPrecise data for N315 RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 1.12 1.13 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)
  2. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]