From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01777
  • pan locus tag?: SAUPAN004288000
  • symbol: engB
  • pan gene symbol?: engB
  • synonym: yihA
  • product: ribosome biogenesis GTP-binding protein YsxC

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_01777
  • symbol: engB
  • product: ribosome biogenesis GTP-binding protein YsxC
  • replicon: chromosome
  • strand: -
  • coordinates: 1677130..1677720
  • length: 591
  • essential: yes [1] DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGAAAGTTAATCCTAATAATATAGAATTAATCATTAGTGCAGTAAAAGAAGAACAATAT
    CCAGAAACAGAATTGTCTGAAGTTGCACTGAGCGGTCGATCTAATGTAGGTAAGTCTACA
    TTTATCAATAGTATGATTGGCAGAAAAAATATGGCACGTACATCACAGCAACCCGGCAAA
    ACGCAAACGTTAAATTTTTATAATATAGATGAACAACTTATTTTTGTGGATGTTCCAGGG
    TATGGATATGCTAAAGTAAGTAAAACACAACGTGAAAAATTTGGGAAAATGATTGAGGAA
    TATATAACTAAGAGAGAGAATTTGCAATTAGTTATTCAATTAGTTGATTTAAGACATGAT
    CCAACACAAGATGATATCTTAATGTACAATTATTTGAAACATTTTGATATTCCTACTTTA
    GTTATATGCACTAAAGAAGACAAAATTCCAAAAGGTAAGGTTCAAAAGCATATTAAAAAT
    ATTAAGACACAATTAGATATGGACCCAGACGATACAATTGTAAGTTATTCATCAATTCAA
    AATAATAAACAACAACAAATATGGAATTTAATTGAACCGTATATTTCATAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    591


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_01777
  • symbol: EngB
  • description: ribosome biogenesis GTP-binding protein YsxC
  • length: 196
  • theoretical pI: 7.58416
  • theoretical MW: 22684.8
  • GRAVY: -0.585204

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YsxC (TIGR03598; HMM-score: 225.8)
    and 13 more
    Genetic information processing Protein synthesis Other GTP-binding protein Era (TIGR00436; HMM-score: 63.9)
    Genetic information processing Protein synthesis Other ribosome-associated GTPase EngA (TIGR03594; HMM-score: 60.6)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTP-binding protein YlqF (TIGR03596; HMM-score: 50.3)
    Genetic information processing Protein synthesis Other ribosome biogenesis GTPase YqeH (TIGR03597; HMM-score: 41.3)
    Unknown function General small GTP-binding protein domain (TIGR00231; HMM-score: 37)
    Genetic information processing Protein fate Protein modification and repair [FeFe] hydrogenase H-cluster maturation GTPase HydF (TIGR03918; HMM-score: 35.1)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA modification GTPase TrmE (TIGR00450; EC 3.6.-.-; HMM-score: 33.1)
    Genetic information processing Protein synthesis Other Obg family GTPase CgtA (TIGR02729; HMM-score: 28)
    Metabolism Transport and binding proteins Cations and iron carrying compounds ferrous iron transport protein B (TIGR00437; HMM-score: 23.8)
    Unknown function General GTP-binding protein HflX (TIGR03156; HMM-score: 19.7)
    Genetic information processing Protein synthesis Translation factors ribosome small subunit-dependent GTPase A (TIGR00157; EC 3.6.-.-; HMM-score: 15.5)
    Metabolism Transport and binding proteins Amino acids, peptides and amines chloroplast protein import component Toc86/159, G and M domains (TIGR00993; HMM-score: 14)
    Metabolism Transport and binding proteins Amino acids, peptides and amines urea ABC transporter, ATP-binding protein UrtE (TIGR03410; HMM-score: 13.9)
  • TheSEED  :
    • GTP-binding protein EngB
    Protein Metabolism Protein biosynthesis Universal GTPases  GTP-binding protein EngB
  • PFAM:
    P-loop_NTPase (CL0023) MMR_HSR1; 50S ribosome-binding GTPase (PF01926; HMM-score: 75.1)
    and 12 more
    FeoB_N; Ferrous iron transport protein B (PF02421; HMM-score: 38.1)
    Dynamin_N; Dynamin family (PF00350; HMM-score: 32.2)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 26.3)
    GTP_EFTU; Elongation factor Tu GTP binding domain (PF00009; HMM-score: 21.1)
    AIG1; AIG1 family (PF04548; HMM-score: 20.8)
    DUF5906; Family of unknown function (DUF5906) (PF19263; HMM-score: 16.5)
    Septin; Septin (PF00735; HMM-score: 16.3)
    IIGP; Interferon-inducible GTPase (IIGP) (PF05049; HMM-score: 15)
    no clan defined WipA_N; WipA, alpha-helical hairpin (PF21662; HMM-score: 14.9)
    Phosphatase (CL0031) Rhodanese; Rhodanese-like domain (PF00581; HMM-score: 13.7)
    P-loop_NTPase (CL0023) cobW; CobW/HypB/UreG, nucleotide-binding domain (PF02492; HMM-score: 12.9)
    AAA_29; P-loop containing region of AAA domain (PF13555; HMM-score: 12.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9958
    • Cytoplasmic Membrane Score: 0.0016
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0026
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.020891
    • TAT(Tat/SPI): 0.005097
    • LIPO(Sec/SPII): 0.002423
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MKVNPNNIELIISAVKEEQYPETELSEVALSGRSNVGKSTFINSMIGRKNMARTSQQPGKTQTLNFYNIDEQLIFVDVPGYGYAKVSKTQREKFGKMIEEYITKRENLQLVIQLVDLRHDPTQDDILMYNYLKHFDIPTLVICTKEDKIPKGKVQKHIKNIKTQLDMDPDDTIVSYSSIQNNKQQQIWNLIEPYIS

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [2] [3]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  4. 4.0 4.1 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]

Elizabeth L Cooper, Jorge García-Lara, Simon J Foster
YsxC, an essential protein in Staphylococcus aureus crucial for ribosome assembly/stability.
BMC Microbiol: 2009, 9;266
[PubMed:20021644] [WorldCat.org] [DOI] (I e)