Jump to navigation
Jump to search
NCBI: 03-AUG-2016
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus NCTC8325
- locus tag: SAOUHSC_02643
- pan locus tag?: SAUPAN005870000
- symbol: SAOUHSC_02643
- pan gene symbol?: hssR
- synonym:
- product: DNA-binding response regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAOUHSC_02643
- symbol: SAOUHSC_02643
- product: DNA-binding response regulator
- replicon: chromosome
- strand: +
- coordinates: 2427987..2428661
- length: 675
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3921205 NCBI
- RefSeq: YP_501105 NCBI
- BioCyc: G1I0R-2490 BioCyc
- MicrobesOnline: 1291076 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661ATGGTGCAATGTCTTGTTGTCGATGACGATCCTCGAATCCTAAATTATATAGCTAGCCAT
TTACAAACAGAGCACATTGATGCATACACACAACCAAGTGGTGAAGCTGCATTAAAACTT
TTAGAAAAACAGCGTGTCGATATTGCAGTGGTAGATATTATGATGGATGGTATGGACGGC
TTTCAATTATGTAATACATTAAAAAATGATTATGATATACCAGTTATTATGTTAACAGCG
CGGGATGCACTTAGTGACAAAGAGCGTGCGTTTATAAGCGGTACTGACGATTATGTAACC
AAACCCTTTGAGGTTAAGGAACTTATTTTTAGAATTCGTGCTGTATTACGTCGATATAAT
ATCAATTCAAATTCAGAAATGACTATTGGCAACTTAACGCTAAACCAATCCTATTTGGAA
CTCCAAGTATCTAATAAAACGATGACGTTACCGAACAAGGAATTTCAATTATTATTTATG
CTTGCAGCACGTCCTAAGCAAATCTTTACTCGTGAACAAATAATAGAAAAAATTTGGGGC
TATGATTATGAAGGAGATGAGCGAACAGTTGACGTTCATATTAAGCGACTACGCCAAAGA
TTAAAAAAATTAAATGCCACACTTACAATTGAAACAGTAAGAGGACAAGGCTATAAGGTG
GAGAATCATGTTTAA60
120
180
240
300
360
420
480
540
600
660
675
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAOUHSC_02643
- symbol: SAOUHSC_02643
- description: DNA-binding response regulator
- length: 224
- theoretical pI: 6.14264
- theoretical MW: 25945.7
- GRAVY: -0.325
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 190.6)Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 190.6)Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 163.6)and 8 moreproteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 98.5)Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 62.5)Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 62.5)Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 62.5)Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 48.8)Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 35.8)Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 15.1)Cellular processes Adaptations to atypical conditions phage shock protein C (TIGR02978; HMM-score: 12.2)
- TheSEED :
- Two-component response regulator colocalized with HrtAB transporter
- PFAM: CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 95.4)HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 94.2)and 6 moreno clan defined Cas_Csm6_6H; CRISPR-associated protein Csm6 6H domain (PF22206; HMM-score: 14.9)CheY (CL0304) VpsR; VpsR domain (PF20161; HMM-score: 14.3)HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 13.4)CheY (CL0304) TadZ-like_ARD; TadZ-like, receiver domain (PF21194; HMM-score: 13.4)no clan defined CNV-Replicase_N; Replicase polyprotein N-term from Coronavirus nsp1 (PF16688; HMM-score: 12.7)Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 12.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: HssS (sensor histidine kinase) sensing heme [1]
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 9.97
- Cytoplasmic Membrane Score: 0
- Cellwall Score: 0.01
- Extracellular Score: 0.02
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9981
- Cytoplasmic Membrane Score: 0.0006
- Cell wall & surface Score: 0
- Extracellular Score: 0.0012
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002251
- TAT(Tat/SPI): 0.000078
- LIPO(Sec/SPII): 0.000351
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MVQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKNDYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINSNSEMTIGNLTLNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLKKLNATLTIETVRGQGYKVENHV
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas [3] [4]
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: [2]
Multi-gene expression profiles
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Devin L Stauff, Victor J Torres, Eric P Skaar
Signaling and DNA-binding activities of the Staphylococcus aureus HssR-HssS two-component system required for heme sensing.
J Biol Chem: 2007, 282(36);26111-21
[PubMed:17635909] [WorldCat.org] [DOI] (P p) - ↑ 2.0 2.1 2.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
PLoS Genet: 2016, 12(4);e1005962
[PubMed:27035918] [WorldCat.org] [DOI] (I e) - ↑ Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
Proteomics: 2015, 15(21);3648-61
[PubMed:26224020] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
Sci Rep: 2017, 7(1);9718
[PubMed:28887440] [WorldCat.org] [DOI] (I e)
