From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_02643
  • pan locus tag?: SAUPAN005870000
  • symbol: SAOUHSC_02643
  • pan gene symbol?: hssR
  • synonym:
  • product: DNA-binding response regulator

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_02643
  • symbol: SAOUHSC_02643
  • product: DNA-binding response regulator
  • replicon: chromosome
  • strand: +
  • coordinates: 2427987..2428661
  • length: 675
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGGTGCAATGTCTTGTTGTCGATGACGATCCTCGAATCCTAAATTATATAGCTAGCCAT
    TTACAAACAGAGCACATTGATGCATACACACAACCAAGTGGTGAAGCTGCATTAAAACTT
    TTAGAAAAACAGCGTGTCGATATTGCAGTGGTAGATATTATGATGGATGGTATGGACGGC
    TTTCAATTATGTAATACATTAAAAAATGATTATGATATACCAGTTATTATGTTAACAGCG
    CGGGATGCACTTAGTGACAAAGAGCGTGCGTTTATAAGCGGTACTGACGATTATGTAACC
    AAACCCTTTGAGGTTAAGGAACTTATTTTTAGAATTCGTGCTGTATTACGTCGATATAAT
    ATCAATTCAAATTCAGAAATGACTATTGGCAACTTAACGCTAAACCAATCCTATTTGGAA
    CTCCAAGTATCTAATAAAACGATGACGTTACCGAACAAGGAATTTCAATTATTATTTATG
    CTTGCAGCACGTCCTAAGCAAATCTTTACTCGTGAACAAATAATAGAAAAAATTTGGGGC
    TATGATTATGAAGGAGATGAGCGAACAGTTGACGTTCATATTAAGCGACTACGCCAAAGA
    TTAAAAAAATTAAATGCCACACTTACAATTGAAACAGTAAGAGGACAAGGCTATAAGGTG
    GAGAATCATGTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    675


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_02643
  • symbol: SAOUHSC_02643
  • description: DNA-binding response regulator
  • length: 224
  • theoretical pI: 6.14264
  • theoretical MW: 25945.7
  • GRAVY: -0.325

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 190.6)
    Signal transduction Signal transduction Two-component systems phosphate regulon transcriptional regulatory protein PhoB (TIGR02154; HMM-score: 190.6)
    Signal transduction Regulatory functions DNA interactions heavy metal response regulator (TIGR01387; HMM-score: 163.6)
    and 8 more
    proteobacterial dedicated sortase system response regulator (TIGR03787; HMM-score: 98.5)
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 62.5)
    Signal transduction Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 62.5)
    Signal transduction Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 62.5)
    Cellular processes Cellular processes Sporulation and germination sporulation transcription factor Spo0A (TIGR02875; HMM-score: 48.8)
    Signal transduction Signal transduction Two-component systems TMAO reductase sytem sensor TorS (TIGR02956; EC 2.7.13.3; HMM-score: 35.8)
    Signal transduction Regulatory functions DNA interactions PEP-CTERM-box response regulator transcription factor (TIGR02915; HMM-score: 15.1)
    Cellular processes Cellular processes Adaptations to atypical conditions phage shock protein C (TIGR02978; HMM-score: 12.2)
  • TheSEED  :
    • Two-component response regulator colocalized with HrtAB transporter
    Iron acquisition and metabolism Iron acquisition and metabolism - no subcategory Heme, hemin uptake and utilization systems in GramPositives  Two-component response regulator colocalized with HrtAB transporter
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 95.4)
    HTH (CL0123) Trans_reg_C; Transcriptional regulatory protein, C terminal (PF00486; HMM-score: 94.2)
    and 6 more
    no clan defined Cas_Csm6_6H; CRISPR-associated protein Csm6 6H domain (PF22206; HMM-score: 14.9)
    CheY (CL0304) VpsR; VpsR domain (PF20161; HMM-score: 14.3)
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 13.4)
    CheY (CL0304) TadZ-like_ARD; TadZ-like, receiver domain (PF21194; HMM-score: 13.4)
    no clan defined CNV-Replicase_N; Replicase polyprotein N-term from Coronavirus nsp1 (PF16688; HMM-score: 12.7)
    Thioredoxin (CL0172) Glutaredoxin; Glutaredoxin (PF00462; HMM-score: 12.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effector: HssS (sensor histidine kinase) sensing heme [1]
  • genes regulated by HssR*, TF important in Heme efflux [2]
    activation

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9981
    • Cytoplasmic Membrane Score: 0.0006
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0012
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.002251
    • TAT(Tat/SPI): 0.000078
    • LIPO(Sec/SPII): 0.000351
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MVQCLVVDDDPRILNYIASHLQTEHIDAYTQPSGEAALKLLEKQRVDIAVVDIMMDGMDGFQLCNTLKNDYDIPVIMLTARDALSDKERAFISGTDDYVTKPFEVKELIFRIRAVLRRYNINSNSEMTIGNLTLNQSYLELQVSNKTMTLPNKEFQLLFMLAARPKQIFTREQIIEKIWGYDYEGDERTVDVHIKRLRQRLKKLNATLTIETVRGQGYKVENHV

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [3] [4]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Devin L Stauff, Victor J Torres, Eric P Skaar
    Signaling and DNA-binding activities of the Staphylococcus aureus HssR-HssS two-component system required for heme sensing.
    J Biol Chem: 2007, 282(36);26111-21
    [PubMed:17635909] [WorldCat.org] [DOI] (P p)
  2. 2.0 2.1 2.2 Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)
  3. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  4. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]