⊟Summary[edit | edit source]
- pan ID?: SAUPAN005052000
- symbol?: —
- synonym:
- description?: putative bacteriophage protein
- putative bacteriophage protein
- phage protein
descriptions from strain specific annotations:
- strand?: -
- coordinates?: 5218493..5219882
- synteny block?: BlockID0039290
- occurrence?: in 56% of 34 strains
tacS (gpG) : serogroup F prophage tail assembly chaperone small subunit [1]
Staphylococcal prophages require tail assembly chaperone proteins (TACs) to coat the tape measure protein and prevent asynchronized and unstructured major tail tube protein binding. They will then nucleate major tail tube protein polymerization and be displaced by major tail tube protein subunits in orderly tail tube assembly. This small subunit is generated approximately 99% of the time - however, at a 1% frequency, a programmed translational frameshift at the A AAT TTT slippery coding sequence results in a longer "TacL" product represented by SAUPAN005050000. The balance of these two chaperone lengths allows TACs to properly coat the tape measure protein and prevent binding of both MtpS and MtpL subunits.
⊟Orthologs[edit | edit source]
⊟Genome Viewer[edit | edit source]
| N315 | |
| Newman | |
| USA300_FPR3757 |
⊟Alignments[edit | edit source]
- alignment of orthologues: CLUSTAL format alignment by MAFFT L-INS-i (v7.505)
N315 MAKLKRNIIQLVEDPKANEIKLQTYLTPHFISFEIVYEAMDLIDDIEDENSTMKPREIAD
Newman MAKLKRNIIQLVEDPKANEIKLQTYLTPHFISFEIVYEAMDLIDDIEDENSTMKPREIAD
USA300_FPR3757 MAKLKRNIIQLVEDPKANEIKLQTYLTPHFISFEIVYEAMDLIDDIEDENSTMKPREIAD
************************************************************
N315 RLMDMVVKIYDNQFTVKDLKERMHAPDGMNALREQVIFITQGQQTEETRNFIQNMK
Newman RLMDMVVKIYDNQFTVKDLKERMHAPDGMNALREQVIFITQGQQTEETRNFIQNMK
USA300_FPR3757 RLMDMVVKIYDNQFAVKDLKERMHAPDGMNALREQVVFITQGQQTEETRNFIQNMK
**************:*********************:*******************
- ↑ Jun Xu, Roger W Hendrix, Robert L Duda
Conserved translational frameshift in dsDNA bacteriophage tail assembly genes.
Mol Cell: 2004, 16(1);11-21
[PubMed:15469818] [WorldCat.org] [DOI] (P p)Lisa G Pell, Nichole Cumby, Teresa E Clark, Ashleigh Tuite, Kevin P Battaile, Aled M Edwards, Nickolay Y Chirgadze, Alan R Davidson, Karen L Maxwell
A conserved spiral structure for highly diverged phage tail assembly chaperones.
J Mol Biol: 2013, 425(14);2436-49
[PubMed:23542344] [WorldCat.org] [DOI] (I p)