From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0421 [new locus tag: SAUSA300_RS02255 ]
  • pan locus tag?: SAUPAN002149000
  • symbol: SAUSA300_0421
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

tlaA1: TslA chaperone and lap secretion-signal protein TlaA1

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0421 [new locus tag: SAUSA300_RS02255 ]
  • symbol: SAUSA300_0421
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 473467..473790
  • length: 324
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGATGTTTAATCAAATTAATAATAAAAATGAATTAGAAGAATCATATGAATCTGAGAAA
    AAACGTATAGAGAATGAACTGCAAAATTTAAATGAACTTAGGCATAGAACTCGAAAAGAA
    AATGAGCGTAGTTATGATGTTTTTCAATATTTGAAGCACGAAATGAATTATAGTGAAGAT
    GCCCAAAGGAAAATGACGAGAAATATAGAAGCGTATGAGCAAGAAATCAATGAGATAATT
    AGAAAGCAAGAATGGAAATTAGAAGAATATAAAGAAGACTTAAAAAAGTCTTATGAAAAG
    CAGTTAGATAAGCTAAGTGACTGA
    60
    120
    180
    240
    300
    324

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_0421 [new locus tag: SAUSA300_RS02255 ]
  • symbol: SAUSA300_0421
  • description: hypothetical protein
  • length: 107
  • theoretical pI: 4.94933
  • theoretical MW: 13457.8
  • GRAVY: -1.69252

⊟Function[edit | edit source]

  • TIGRFAM:
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02169; HMM-score: 9)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02169; HMM-score: 9)
    Cellular processes Cellular processes Cell division chromosome segregation protein SMC (TIGR02168; HMM-score: 7.9)
    Genetic information processing DNA metabolism Chromosome-associated proteins chromosome segregation protein SMC (TIGR02168; HMM-score: 7.9)
    and 4 more
    Genetic information processing DNA metabolism Other MutS2 family protein (TIGR01069; HMM-score: 5.6)
    two transmembrane protein (TIGR04527; HMM-score: 5.6)
    Genetic information processing Transcription Degradation of RNA ribonuclease Y (TIGR03319; EC 3.1.-.-; HMM-score: 3.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 3.1)
  • TheSEED  :
    • FIG01107979: hypothetical protein
  • PFAM:
    dUTPase (CL0153) Herpes_U55; Human herpesvirus U55 protein (PF06501; HMM-score: 14)
    no clan defined KxDL; Uncharacterized conserved protein (PF10241; HMM-score: 13.5)
    6PGD_C (CL0106) Octopine_DH; NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain (PF02317; HMM-score: 11.9)
    no clan defined DUF2959; Protein of unknown function (DUF2959) (PF11172; HMM-score: 11.7)
    and 9 more
    YlqD; YlqD protein (PF11068; HMM-score: 10.4)
    HAUS6_N; HAUS augmin-like complex subunit 6 N-terminus (PF14661; HMM-score: 9.6)
    HIP1_clath_bdg; Clathrin-binding domain of Huntingtin-interacting protein 1 (PF16515; HMM-score: 9.5)
    Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 8.7)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 8.4)
    CREPT; Cell-cycle alteration and expression-elevated protein in tumour (PF16566; HMM-score: 8.2)
    OmpH; Outer membrane protein (OmpH-like) (PF03938; HMM-score: 7.3)
    IncA; IncA protein (PF04156; HMM-score: 6)
    V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005221
    • TAT(Tat/SPI): 0.000691
    • LIPO(Sec/SPII): 0.001015
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MMFNQINNKNELEESYESEKKRIENELQNLNELRHRTRKENERSYDVFQYLKHEMNYSEDAQRKMTRNIEAYEQEINEIIRKQEWKLEEYKEDLKKSYEKQLDKLSD

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

[1]

  1. ↑ Stephen R Garrett, Nicole Mietrach, Justin Deme, Alina Bitzer, Yaping Yang, Fatima R Ulhuq, Dorothee Kretschmer, Simon Heilbronner, Terry K Smith, Susan M Lea, Tracy Palmer
    A type VII-secreted lipase toxin with reverse domain arrangement.
    Nat Commun: 2023, 14(1);8438
    [PubMed:38114483] [WorldCat.org] [DOI] (I e)
Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_0421&oldid=104120"