From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0422 [new locus tag: SAUSA300_RS02260 ]
  • pan locus tag?: SAUPAN002150000
  • symbol: SAUSA300_0422
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

tlaA2: TslA chaperone and lap secretion-signal protein TlaA2

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0422 [new locus tag: SAUSA300_RS02260 ]
  • symbol: SAUSA300_0422
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 473809..474123
  • length: 315
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGACTCTAATAGAACCAGATATGACCTTAAGAATGCCAGATATAAGTACTACAGTAGAA
    ACACTTAATCTCATATCTAAAATGGAAGCGCAAAAAGAAAATATTCGCACAGTTATTGCA
    CCTGAACATAAGCATAAATACAAAGATATTGAAAACGGATTAAAAGGTGAAGAAAAAGTA
    TTAATTGAACAAATGGCGCAACATTGCGAAGCTTTTAAAGCTAATTTTAAAGGTGCAGCT
    CAAGGAGATTGGGTTAAAAGTGCCATGTCTGAGATAGACAGCATTAAGGATGACCTGAAA
    AAAATTAATAGCTAA
    60
    120
    180
    240
    300
    315

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0422 [new locus tag: SAUSA300_RS02260 ]
  • symbol: SAUSA300_0422
  • description: hypothetical protein
  • length: 104
  • theoretical pI: 5.68422
  • theoretical MW: 11788.5
  • GRAVY: -0.568269

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108405: hypothetical protein
  • PFAM:
    no clan defined KMP11; Kinetoplastid membrane protein 11 (PF03037; HMM-score: 17)
    DUF4276; Domain of unknown function (DUF4276) (PF14103; HMM-score: 14.1)
    and 1 more
    DUF1204; Protein of unknown function (DUF1204) (PF06721; HMM-score: 13.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011561
    • TAT(Tat/SPI): 0.000399
    • LIPO(Sec/SPII): 0.001161
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTLIEPDMTLRMPDISTTVETLNLISKMEAQKENIRTVIAPEHKHKYKDIENGLKGEEKVLIEQMAQHCEAFKANFKGAAQGDWVKSAMSEIDSIKDDLKKINS

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]

[1]

  1. Stephen R Garrett, Nicole Mietrach, Justin Deme, Alina Bitzer, Yaping Yang, Fatima R Ulhuq, Dorothee Kretschmer, Simon Heilbronner, Terry K Smith, Susan M Lea, Tracy Palmer
    A type VII-secreted lipase toxin with reverse domain arrangement.
    Nat Commun: 2023, 14(1);8438
    [PubMed:38114483] [WorldCat.org] [DOI] (I e)